Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GGJ9

Protein Details
Accession A0A2I2GGJ9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTLRKKQKKKEEIRDPLPNPIPHydrophilic
NLS Segment(s)
PositionSequence
4-38RKKQKKKEEIRDPLPNPIPNEKKFSVARRLKASNK
Subcellular Location(s) nucl 18.5, mito_nucl 12, mito 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MTLRKKQKKKEEIRDPLPNPIPNEKKFSVARRLKASNKTRKTNFPIPTPQWIRCPTPPKADMTFLPSVFSDGTTLNDSTGAEDHWLLFPRYIRGYAVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.82
3 0.8
4 0.75
5 0.68
6 0.61
7 0.6
8 0.59
9 0.51
10 0.56
11 0.48
12 0.47
13 0.48
14 0.49
15 0.5
16 0.5
17 0.53
18 0.52
19 0.58
20 0.59
21 0.64
22 0.68
23 0.68
24 0.69
25 0.72
26 0.69
27 0.71
28 0.72
29 0.71
30 0.65
31 0.6
32 0.6
33 0.54
34 0.59
35 0.55
36 0.48
37 0.45
38 0.44
39 0.42
40 0.4
41 0.44
42 0.38
43 0.42
44 0.42
45 0.41
46 0.4
47 0.39
48 0.33
49 0.33
50 0.33
51 0.26
52 0.25
53 0.21
54 0.19
55 0.17
56 0.16
57 0.11
58 0.08
59 0.11
60 0.12
61 0.12
62 0.11
63 0.12
64 0.11
65 0.12
66 0.12
67 0.1
68 0.09
69 0.09
70 0.1
71 0.12
72 0.15
73 0.15
74 0.16
75 0.18
76 0.22
77 0.24
78 0.25