Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GPJ9

Protein Details
Accession A0A2I2GPJ9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
225-252VTYKRTQLEDPPKGKKRRKVTEEVTEKEHydrophilic
NLS Segment(s)
PositionSequence
237-243KGKKRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPSIKPTLHPLKTPQPMVFPSELQRNPDTGTSLSGNGSGRPGDEPLCTPITPPAAYTEFLKAFTPIFSPDSARGENGRFRFDKPFERSAITNANHYLNPPSATSNPGSGSGNTSAPTSQPASAVSTSFNFNESARSATASLPPPTPYGAPFPRRDPRNLRSLRIPGSGPIPPRYSPTSMSMGESPRSATMLRSPYSPSDWKMRYYEGPRSANSRVSVRHVVTHTVTYKRTQLEDPPKGKKRRKVTEEVTEKETTKSGDEEDEDASSEDSEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.51
3 0.49
4 0.51
5 0.46
6 0.39
7 0.36
8 0.41
9 0.41
10 0.4
11 0.39
12 0.35
13 0.35
14 0.34
15 0.32
16 0.23
17 0.24
18 0.21
19 0.21
20 0.19
21 0.2
22 0.19
23 0.17
24 0.18
25 0.14
26 0.14
27 0.14
28 0.15
29 0.14
30 0.15
31 0.16
32 0.18
33 0.21
34 0.2
35 0.19
36 0.21
37 0.24
38 0.22
39 0.2
40 0.21
41 0.2
42 0.21
43 0.22
44 0.23
45 0.2
46 0.22
47 0.22
48 0.18
49 0.16
50 0.16
51 0.16
52 0.13
53 0.14
54 0.13
55 0.15
56 0.17
57 0.21
58 0.21
59 0.21
60 0.21
61 0.23
62 0.28
63 0.27
64 0.3
65 0.27
66 0.29
67 0.36
68 0.37
69 0.43
70 0.43
71 0.46
72 0.43
73 0.44
74 0.42
75 0.38
76 0.42
77 0.34
78 0.3
79 0.27
80 0.27
81 0.24
82 0.24
83 0.23
84 0.16
85 0.17
86 0.15
87 0.16
88 0.15
89 0.17
90 0.17
91 0.16
92 0.16
93 0.16
94 0.16
95 0.14
96 0.16
97 0.15
98 0.15
99 0.13
100 0.13
101 0.11
102 0.1
103 0.12
104 0.11
105 0.1
106 0.1
107 0.1
108 0.12
109 0.12
110 0.12
111 0.11
112 0.11
113 0.12
114 0.11
115 0.11
116 0.1
117 0.09
118 0.11
119 0.11
120 0.11
121 0.1
122 0.11
123 0.11
124 0.11
125 0.15
126 0.16
127 0.16
128 0.16
129 0.16
130 0.16
131 0.16
132 0.16
133 0.13
134 0.16
135 0.21
136 0.25
137 0.26
138 0.32
139 0.39
140 0.41
141 0.46
142 0.48
143 0.46
144 0.51
145 0.52
146 0.48
147 0.47
148 0.5
149 0.47
150 0.41
151 0.38
152 0.28
153 0.28
154 0.28
155 0.24
156 0.23
157 0.23
158 0.21
159 0.24
160 0.27
161 0.26
162 0.25
163 0.27
164 0.28
165 0.26
166 0.27
167 0.26
168 0.25
169 0.24
170 0.22
171 0.19
172 0.14
173 0.15
174 0.13
175 0.11
176 0.15
177 0.19
178 0.2
179 0.2
180 0.22
181 0.23
182 0.28
183 0.31
184 0.27
185 0.31
186 0.32
187 0.34
188 0.34
189 0.36
190 0.38
191 0.41
192 0.47
193 0.46
194 0.48
195 0.46
196 0.49
197 0.48
198 0.46
199 0.43
200 0.38
201 0.32
202 0.35
203 0.4
204 0.35
205 0.38
206 0.35
207 0.36
208 0.34
209 0.37
210 0.35
211 0.34
212 0.35
213 0.31
214 0.35
215 0.34
216 0.35
217 0.32
218 0.38
219 0.44
220 0.53
221 0.58
222 0.63
223 0.7
224 0.77
225 0.83
226 0.82
227 0.82
228 0.83
229 0.84
230 0.84
231 0.83
232 0.84
233 0.84
234 0.8
235 0.75
236 0.67
237 0.6
238 0.51
239 0.45
240 0.35
241 0.28
242 0.25
243 0.21
244 0.21
245 0.23
246 0.23
247 0.23
248 0.22
249 0.2
250 0.19
251 0.18
252 0.14