Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GJW7

Protein Details
Accession A0A2I2GJW7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-92VSGKGGTETRHRRRRRRSPSYVEYIEKBasic
NLS Segment(s)
PositionSequence
75-83RHRRRRRRS
Subcellular Location(s) plas 7, extr 6, cyto 5, mito 4, nucl 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPMNILHARQESSGGSDNCPSTISGGAIAGIVIGSIAGTLLILWLFKVCALPGARDGGEPDYGYVSGKGGTETRHRRRRRRSPSYVEYIEKPPRSVRRPAKVYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.26
5 0.26
6 0.24
7 0.24
8 0.2
9 0.14
10 0.14
11 0.12
12 0.09
13 0.09
14 0.08
15 0.07
16 0.07
17 0.05
18 0.04
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.07
38 0.08
39 0.09
40 0.1
41 0.12
42 0.12
43 0.11
44 0.13
45 0.1
46 0.1
47 0.1
48 0.09
49 0.08
50 0.08
51 0.08
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.08
58 0.1
59 0.19
60 0.3
61 0.4
62 0.49
63 0.58
64 0.68
65 0.78
66 0.86
67 0.88
68 0.89
69 0.89
70 0.89
71 0.89
72 0.87
73 0.82
74 0.75
75 0.68
76 0.65
77 0.63
78 0.55
79 0.49
80 0.48
81 0.51
82 0.53
83 0.59
84 0.62
85 0.63
86 0.67