Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FX68

Protein Details
Accession A0A2I2FX68    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-70QERYARAKRNRDQARENRKRIEBasic
NLS Segment(s)
PositionSequence
56-68KRNRDQARENRKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MHSHLHTPQNANCEEIMTALDECHARGFLHKALGNCNDIKRDVNKCLSQERYARAKRNRDQARENRKRIEKIWADEKAAERGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.16
4 0.1
5 0.1
6 0.08
7 0.1
8 0.08
9 0.09
10 0.09
11 0.09
12 0.08
13 0.09
14 0.13
15 0.13
16 0.18
17 0.2
18 0.2
19 0.23
20 0.26
21 0.27
22 0.25
23 0.24
24 0.21
25 0.2
26 0.21
27 0.22
28 0.23
29 0.24
30 0.27
31 0.28
32 0.29
33 0.34
34 0.35
35 0.35
36 0.35
37 0.37
38 0.42
39 0.45
40 0.52
41 0.55
42 0.61
43 0.63
44 0.7
45 0.74
46 0.71
47 0.75
48 0.77
49 0.8
50 0.81
51 0.81
52 0.8
53 0.79
54 0.77
55 0.69
56 0.69
57 0.65
58 0.61
59 0.64
60 0.59
61 0.54
62 0.54
63 0.54
64 0.5