Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FZG6

Protein Details
Accession A0A2I2FZG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-51EKLTPGKNYWRQGKRKKKRTPDIYFNVVHydrophilic
NLS Segment(s)
PositionSequence
34-42RQGKRKKKR
Subcellular Location(s) mito 15, extr 5, cyto 2, plas 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MKKANSVVALRSLADVFSFVASLEKLTPGKNYWRQGKRKKKRTPDIYFNVVIPPGLSDGSALLHFSTLPELGRFLVTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.08
5 0.07
6 0.06
7 0.07
8 0.06
9 0.07
10 0.07
11 0.09
12 0.1
13 0.1
14 0.12
15 0.14
16 0.22
17 0.28
18 0.35
19 0.42
20 0.5
21 0.6
22 0.69
23 0.78
24 0.8
25 0.84
26 0.87
27 0.88
28 0.89
29 0.9
30 0.88
31 0.87
32 0.82
33 0.77
34 0.68
35 0.58
36 0.48
37 0.37
38 0.28
39 0.18
40 0.12
41 0.08
42 0.07
43 0.06
44 0.05
45 0.06
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.08
55 0.09
56 0.09
57 0.1
58 0.11