Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FYK6

Protein Details
Accession A0A2I2FYK6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-28GLRPTVRARPARQKAERKTREATHydrophilic
51-94RYGERREKEKGKKEKDRKERERKRARGGRRRVKKRERPVIGFAABasic
NLS Segment(s)
PositionSequence
14-23RPARQKAERK
48-87WRVRYGERREKEKGKKEKDRKERERKRARGGRRRVKKRER
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MSTVGGLRPTVRARPARQKAERKTREATDRDEGEVESREIKGRALIIWRVRYGERREKEKGKKEKDRKERERKRARGGRRRVKKRERPVIGFAAVGGQEVLVDRPGILSGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.67
4 0.74
5 0.79
6 0.82
7 0.86
8 0.86
9 0.8
10 0.77
11 0.73
12 0.72
13 0.66
14 0.61
15 0.58
16 0.52
17 0.47
18 0.42
19 0.35
20 0.28
21 0.26
22 0.21
23 0.14
24 0.13
25 0.13
26 0.13
27 0.12
28 0.11
29 0.1
30 0.11
31 0.13
32 0.16
33 0.19
34 0.21
35 0.22
36 0.22
37 0.23
38 0.28
39 0.31
40 0.36
41 0.36
42 0.4
43 0.45
44 0.52
45 0.6
46 0.64
47 0.68
48 0.68
49 0.75
50 0.79
51 0.84
52 0.86
53 0.88
54 0.89
55 0.91
56 0.91
57 0.92
58 0.93
59 0.9
60 0.9
61 0.88
62 0.88
63 0.87
64 0.87
65 0.87
66 0.87
67 0.9
68 0.9
69 0.92
70 0.92
71 0.93
72 0.92
73 0.9
74 0.85
75 0.81
76 0.75
77 0.65
78 0.54
79 0.43
80 0.35
81 0.26
82 0.2
83 0.13
84 0.07
85 0.06
86 0.07
87 0.08
88 0.06
89 0.06
90 0.06
91 0.06