Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GNL8

Protein Details
Accession A0A2I2GNL8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-126RDTYNPSRRVQKRRHGFLARLRSRGGRKIIMRRRAKGRKNMSWHydrophilic
NLS Segment(s)
PositionSequence
91-123RRVQKRRHGFLARLRSRGGRKIIMRRRAKGRKN
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCIRCRALPSALRTFSTSTLSRSSSQISSPLRSLATTLPSVRTQSPTLASLRAQFPSNNATTPLASALQSRSFSASASLGAKRDTYNPSRRVQKRRHGFLARLRSRGGRKIIMRRRAKGRKNMSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.37
4 0.36
5 0.31
6 0.24
7 0.26
8 0.27
9 0.27
10 0.26
11 0.28
12 0.24
13 0.24
14 0.28
15 0.28
16 0.28
17 0.27
18 0.27
19 0.24
20 0.22
21 0.23
22 0.17
23 0.17
24 0.16
25 0.16
26 0.17
27 0.18
28 0.21
29 0.2
30 0.22
31 0.2
32 0.19
33 0.2
34 0.19
35 0.19
36 0.18
37 0.17
38 0.17
39 0.18
40 0.17
41 0.16
42 0.14
43 0.15
44 0.17
45 0.17
46 0.15
47 0.14
48 0.14
49 0.13
50 0.13
51 0.12
52 0.09
53 0.08
54 0.09
55 0.09
56 0.11
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.12
63 0.11
64 0.1
65 0.11
66 0.12
67 0.11
68 0.12
69 0.13
70 0.12
71 0.16
72 0.2
73 0.26
74 0.33
75 0.38
76 0.43
77 0.53
78 0.61
79 0.67
80 0.71
81 0.74
82 0.75
83 0.79
84 0.82
85 0.78
86 0.76
87 0.76
88 0.78
89 0.73
90 0.65
91 0.59
92 0.57
93 0.56
94 0.56
95 0.53
96 0.5
97 0.52
98 0.6
99 0.68
100 0.71
101 0.74
102 0.75
103 0.8
104 0.83
105 0.84
106 0.84