Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2GI33

Protein Details
Accession A0A2I2GI33   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-48GIRGETRGEKRRRREGEKRKREGKRKGKGSRETABasic
NLS Segment(s)
PositionSequence
20-44TRGEKRRRREGEKRKREGKRKGKGS
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, pero 4
Family & Domain DBs
Amino Acid Sequences MDWAWGRQEASEEGGIRGETRGEKRRRREGEKRKREGKRKGKGSRETAIDAGTASCTFFLWSFWLSGAQTNKQTYVEQQRDDRPTLHGDLNRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.15
5 0.13
6 0.15
7 0.21
8 0.3
9 0.38
10 0.47
11 0.55
12 0.65
13 0.72
14 0.76
15 0.81
16 0.82
17 0.85
18 0.87
19 0.88
20 0.88
21 0.88
22 0.89
23 0.89
24 0.88
25 0.87
26 0.86
27 0.86
28 0.85
29 0.84
30 0.79
31 0.73
32 0.65
33 0.57
34 0.47
35 0.38
36 0.28
37 0.2
38 0.14
39 0.1
40 0.07
41 0.05
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.08
50 0.08
51 0.1
52 0.09
53 0.14
54 0.17
55 0.19
56 0.23
57 0.23
58 0.25
59 0.25
60 0.25
61 0.28
62 0.35
63 0.38
64 0.38
65 0.42
66 0.49
67 0.52
68 0.54
69 0.48
70 0.41
71 0.39
72 0.39
73 0.4
74 0.36