Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2G5V2

Protein Details
Accession A0A2I2G5V2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-30VEGGWKGKKKADRQVGRPRSHNRQHHLBasic
NLS Segment(s)
PositionSequence
9-20KGKKKADRQVGR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 6
Family & Domain DBs
Amino Acid Sequences MMEVEGGWKGKKKADRQVGRPRSHNRQHHLLPTTVCTTDPRKSKTSSSAWVFFRTPYLRGPIPNRQLDSDTRCGCKRMTGAILKSYNPTIQVLNLTKPPRGVRMYIIEKSVACGFRLTCWHARADGPFRARRLVRMSLGHGLRDETRLIEEGTRVGTDVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.71
4 0.8
5 0.84
6 0.83
7 0.83
8 0.81
9 0.81
10 0.81
11 0.8
12 0.76
13 0.75
14 0.73
15 0.73
16 0.68
17 0.61
18 0.52
19 0.47
20 0.43
21 0.34
22 0.3
23 0.25
24 0.26
25 0.29
26 0.35
27 0.36
28 0.37
29 0.4
30 0.43
31 0.47
32 0.48
33 0.49
34 0.47
35 0.49
36 0.47
37 0.47
38 0.44
39 0.36
40 0.36
41 0.3
42 0.26
43 0.21
44 0.24
45 0.22
46 0.25
47 0.31
48 0.35
49 0.4
50 0.42
51 0.41
52 0.38
53 0.39
54 0.39
55 0.39
56 0.37
57 0.32
58 0.32
59 0.31
60 0.31
61 0.29
62 0.27
63 0.23
64 0.19
65 0.21
66 0.22
67 0.23
68 0.27
69 0.29
70 0.26
71 0.26
72 0.24
73 0.2
74 0.16
75 0.16
76 0.1
77 0.1
78 0.14
79 0.14
80 0.15
81 0.2
82 0.2
83 0.2
84 0.23
85 0.23
86 0.24
87 0.25
88 0.24
89 0.22
90 0.29
91 0.34
92 0.33
93 0.33
94 0.29
95 0.26
96 0.27
97 0.28
98 0.2
99 0.15
100 0.15
101 0.14
102 0.16
103 0.2
104 0.23
105 0.24
106 0.25
107 0.25
108 0.25
109 0.27
110 0.3
111 0.32
112 0.34
113 0.36
114 0.39
115 0.39
116 0.44
117 0.43
118 0.43
119 0.43
120 0.42
121 0.4
122 0.4
123 0.43
124 0.44
125 0.44
126 0.4
127 0.35
128 0.32
129 0.28
130 0.27
131 0.23
132 0.16
133 0.17
134 0.17
135 0.18
136 0.17
137 0.16
138 0.15
139 0.17
140 0.16