Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2G326

Protein Details
Accession A0A2I2G326    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MDPFKARPHYNNIRRRQKKLRDNIMGIHydrophilic
NLS Segment(s)
PositionSequence
14-45RRRQKKLRDNIMGITRPAIRRLARRGGIIRIK
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPFKARPHYNNIRRRQKKLRDNIMGITRPAIRRLARRGGIIRIKKEIYNEVRLSIRERLHDILKQVVLVVESSESVKRPRKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.86
5 0.86
6 0.87
7 0.87
8 0.84
9 0.79
10 0.76
11 0.72
12 0.64
13 0.53
14 0.45
15 0.38
16 0.3
17 0.29
18 0.28
19 0.23
20 0.27
21 0.32
22 0.37
23 0.35
24 0.38
25 0.38
26 0.41
27 0.46
28 0.44
29 0.4
30 0.36
31 0.36
32 0.33
33 0.33
34 0.34
35 0.3
36 0.33
37 0.32
38 0.3
39 0.31
40 0.3
41 0.32
42 0.3
43 0.28
44 0.23
45 0.26
46 0.27
47 0.28
48 0.3
49 0.28
50 0.27
51 0.25
52 0.23
53 0.2
54 0.17
55 0.15
56 0.12
57 0.11
58 0.07
59 0.07
60 0.09
61 0.11
62 0.12
63 0.19
64 0.27