Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2GJX7

Protein Details
Accession A0A2I2GJX7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-91LIDVDRPRAKKKSKKESPTRGSNPQPCDHydrophilic
NLS Segment(s)
PositionSequence
70-80PRAKKKSKKES
Subcellular Location(s) golg 7, mito 6, extr 5, cyto 3, nucl 2, E.R. 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSWYLSAIGFLCACIRYKRERCQPHSGDSCGKKLGEFDNQKGTSRSSSPFTFFIYYLLCVVCWLIDVDRPRAKKKSKKESPTRGSNPQPCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.27
4 0.35
5 0.45
6 0.54
7 0.63
8 0.68
9 0.76
10 0.76
11 0.74
12 0.72
13 0.66
14 0.64
15 0.57
16 0.52
17 0.44
18 0.39
19 0.31
20 0.27
21 0.26
22 0.27
23 0.28
24 0.28
25 0.34
26 0.35
27 0.37
28 0.36
29 0.34
30 0.26
31 0.25
32 0.24
33 0.19
34 0.19
35 0.2
36 0.2
37 0.21
38 0.2
39 0.18
40 0.17
41 0.15
42 0.14
43 0.12
44 0.11
45 0.09
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.09
53 0.12
54 0.18
55 0.24
56 0.28
57 0.33
58 0.41
59 0.51
60 0.57
61 0.65
62 0.7
63 0.75
64 0.83
65 0.88
66 0.91
67 0.9
68 0.92
69 0.88
70 0.86
71 0.86