Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MNL6

Protein Details
Accession B8MNL6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
113-137NDPLKPFRWIRRKVKGEKNVWRKLSHydrophilic
NLS Segment(s)
PositionSequence
120-134RWIRRKVKGEKNVWR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MAVPTSTDPSPDEGENNGHGQQSRTSPSELPAHHDQDPRPSELPSHTVSNVESEALPNYSRRPDSNAPRLPSYARVERTDRLRRESWQTFIESKMYGPDTFGGHKGITDGPPNDPLKPFRWIRRKVKGEKNVWRKLSVEERRKWEEEGGPVNYDAGECLLYLTRGLASLIKLAAAGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.22
5 0.21
6 0.21
7 0.22
8 0.23
9 0.24
10 0.27
11 0.26
12 0.28
13 0.27
14 0.29
15 0.35
16 0.32
17 0.34
18 0.36
19 0.38
20 0.4
21 0.44
22 0.41
23 0.43
24 0.46
25 0.44
26 0.38
27 0.34
28 0.31
29 0.29
30 0.32
31 0.25
32 0.26
33 0.21
34 0.21
35 0.21
36 0.21
37 0.18
38 0.15
39 0.12
40 0.1
41 0.1
42 0.11
43 0.11
44 0.1
45 0.12
46 0.15
47 0.17
48 0.17
49 0.23
50 0.3
51 0.38
52 0.47
53 0.52
54 0.5
55 0.51
56 0.51
57 0.45
58 0.42
59 0.39
60 0.35
61 0.31
62 0.32
63 0.33
64 0.35
65 0.43
66 0.46
67 0.43
68 0.43
69 0.41
70 0.41
71 0.46
72 0.45
73 0.4
74 0.33
75 0.33
76 0.28
77 0.27
78 0.26
79 0.18
80 0.15
81 0.14
82 0.14
83 0.11
84 0.1
85 0.11
86 0.11
87 0.12
88 0.13
89 0.12
90 0.1
91 0.1
92 0.11
93 0.11
94 0.11
95 0.14
96 0.14
97 0.14
98 0.21
99 0.22
100 0.22
101 0.23
102 0.25
103 0.24
104 0.3
105 0.33
106 0.36
107 0.45
108 0.53
109 0.6
110 0.68
111 0.75
112 0.78
113 0.84
114 0.84
115 0.84
116 0.85
117 0.86
118 0.84
119 0.77
120 0.69
121 0.6
122 0.56
123 0.57
124 0.57
125 0.56
126 0.54
127 0.59
128 0.64
129 0.64
130 0.6
131 0.54
132 0.49
133 0.46
134 0.45
135 0.4
136 0.35
137 0.33
138 0.32
139 0.27
140 0.22
141 0.16
142 0.1
143 0.07
144 0.06
145 0.07
146 0.07
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.09
153 0.09
154 0.1
155 0.12
156 0.12
157 0.11