Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2G8F1

Protein Details
Accession A0A2I2G8F1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-96EKVMKSPSDQTRKRCRNHRRMVPVHQPCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7plas 7extr 7, E.R. 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRSTCPSFPVLPPSLIARANCFLALFSFVSYTSILCVIGYPPYLSVYLELLEYDCPASNLELHTLPSEKVMKSPSDQTRKRCRNHRRMVPVHQPCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.28
4 0.24
5 0.23
6 0.23
7 0.22
8 0.19
9 0.15
10 0.13
11 0.15
12 0.11
13 0.09
14 0.09
15 0.09
16 0.1
17 0.1
18 0.09
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.05
25 0.06
26 0.07
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.09
48 0.09
49 0.1
50 0.11
51 0.11
52 0.11
53 0.14
54 0.17
55 0.15
56 0.17
57 0.19
58 0.19
59 0.21
60 0.3
61 0.36
62 0.44
63 0.5
64 0.57
65 0.66
66 0.73
67 0.79
68 0.81
69 0.83
70 0.83
71 0.88
72 0.9
73 0.89
74 0.89
75 0.9
76 0.9