Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FKG5

Protein Details
Accession A0A2G7FKG5   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-24LSSARQTRRSLPQPKKTLSRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR022036  DUF3605  
Pfam View protein in Pfam  
PF12239  DUF3605  
Amino Acid Sequences MRRLSSARQTRRSLPQPKKTLSRILVGGDTSQLKRTPTDLRHYIFWTREIQATFGSVTNFLVKTRLHWGKEANNAETRFPYCHSFPSADQSDYRMLHNDWPYAMSSGMAHLVVWLNTPIPVDAEGDLTTEPRRLVADFIDRTFTMHMSREHAGNNIQWFKNRIKWQSIRALEHIYIILRDVDDEFVTKLTGQGPDDIECKSYSTSVSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.79
4 0.81
5 0.82
6 0.77
7 0.76
8 0.69
9 0.63
10 0.55
11 0.48
12 0.43
13 0.36
14 0.31
15 0.25
16 0.25
17 0.21
18 0.22
19 0.21
20 0.2
21 0.21
22 0.24
23 0.29
24 0.31
25 0.38
26 0.42
27 0.43
28 0.45
29 0.48
30 0.49
31 0.42
32 0.4
33 0.35
34 0.3
35 0.32
36 0.29
37 0.26
38 0.21
39 0.2
40 0.18
41 0.16
42 0.14
43 0.11
44 0.11
45 0.12
46 0.12
47 0.11
48 0.13
49 0.12
50 0.14
51 0.23
52 0.28
53 0.27
54 0.29
55 0.33
56 0.36
57 0.45
58 0.46
59 0.4
60 0.4
61 0.39
62 0.38
63 0.35
64 0.31
65 0.24
66 0.22
67 0.22
68 0.17
69 0.19
70 0.2
71 0.2
72 0.19
73 0.25
74 0.26
75 0.23
76 0.22
77 0.22
78 0.24
79 0.22
80 0.22
81 0.18
82 0.16
83 0.2
84 0.21
85 0.19
86 0.15
87 0.15
88 0.15
89 0.14
90 0.13
91 0.08
92 0.06
93 0.06
94 0.07
95 0.06
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.07
119 0.08
120 0.08
121 0.09
122 0.11
123 0.18
124 0.18
125 0.19
126 0.21
127 0.2
128 0.21
129 0.21
130 0.19
131 0.13
132 0.15
133 0.16
134 0.17
135 0.18
136 0.19
137 0.19
138 0.2
139 0.2
140 0.2
141 0.25
142 0.27
143 0.27
144 0.28
145 0.31
146 0.32
147 0.39
148 0.44
149 0.43
150 0.46
151 0.51
152 0.55
153 0.61
154 0.63
155 0.59
156 0.55
157 0.54
158 0.45
159 0.41
160 0.35
161 0.26
162 0.2
163 0.16
164 0.14
165 0.09
166 0.1
167 0.09
168 0.1
169 0.1
170 0.11
171 0.1
172 0.1
173 0.11
174 0.1
175 0.1
176 0.12
177 0.14
178 0.14
179 0.18
180 0.19
181 0.21
182 0.23
183 0.22
184 0.21
185 0.19
186 0.2
187 0.17
188 0.16
189 0.15