Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FUR9

Protein Details
Accession A0A2G7FUR9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-58SDDWILKQRKKRRRWICCGFLIHydrophilic
NLS Segment(s)
PositionSequence
45-49RKKRR
Subcellular Location(s) plas 16, mito 6, cyto 2, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALVRDPAFWRRFSRAIHLDEEAKASKTENKSRVIYSDDWILKQRKKRRRWICCGFLIFAAFAIVVAGAVVVLWWFHSHNWLRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.47
4 0.46
5 0.44
6 0.4
7 0.36
8 0.37
9 0.29
10 0.23
11 0.2
12 0.18
13 0.21
14 0.26
15 0.33
16 0.34
17 0.38
18 0.39
19 0.39
20 0.4
21 0.38
22 0.33
23 0.26
24 0.29
25 0.25
26 0.23
27 0.27
28 0.3
29 0.3
30 0.36
31 0.44
32 0.46
33 0.54
34 0.64
35 0.7
36 0.76
37 0.82
38 0.84
39 0.81
40 0.79
41 0.73
42 0.63
43 0.53
44 0.43
45 0.33
46 0.23
47 0.16
48 0.09
49 0.06
50 0.05
51 0.04
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.04
62 0.06
63 0.06
64 0.15
65 0.23