Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FH37

Protein Details
Accession A0A2G7FH37   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-171QMFKPQKNFLSKKRRRKHKDEVFTVRSHydrophilic
NLS Segment(s)
PositionSequence
155-163SKKRRRKHK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
Pfam View protein in Pfam  
PF00339  Arrestin_N  
Amino Acid Sequences MLTIQLENQLACYSGHEHLRGCVVYHCPNPIDIQEVRVSFYGRAKAKVQKVKGAAAPAATYRSKCILFQEEKILVTPNGGQLARNTYEWPFEFTFPSQVESPAKWPEKAPFRSDEHHPLPPSFAADVGDSQRKLHCVIEYRIEVQMFKPQKNFLSKKRRRKHKDEVFTVRSLLLLPENRGRSLKVGEKFQSWLSKKQLPQFDFKASFLYSTRVLQGAPVACLLDIIPCTDGSSMPFPGITLQSVSIAVMSRTSARASQSLRGSITGDVDDRLEILSKTSLGMPVLGQLDLNETFGPLIFRHSDVSFSTFTISRSYRLCASFTFECVGKTFEFNANDLEFFIVSDVVSPTVQMTPMEQGTAITGVFELPDTASRRSSSDEYDESPPSYSMTAATSEKPGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.24
4 0.25
5 0.25
6 0.3
7 0.28
8 0.25
9 0.26
10 0.27
11 0.32
12 0.34
13 0.36
14 0.32
15 0.33
16 0.34
17 0.3
18 0.3
19 0.24
20 0.24
21 0.25
22 0.25
23 0.26
24 0.25
25 0.26
26 0.23
27 0.27
28 0.32
29 0.29
30 0.33
31 0.36
32 0.44
33 0.51
34 0.58
35 0.57
36 0.57
37 0.58
38 0.6
39 0.57
40 0.53
41 0.45
42 0.36
43 0.34
44 0.27
45 0.28
46 0.25
47 0.22
48 0.21
49 0.24
50 0.24
51 0.23
52 0.27
53 0.32
54 0.34
55 0.36
56 0.41
57 0.39
58 0.38
59 0.38
60 0.35
61 0.26
62 0.23
63 0.22
64 0.16
65 0.18
66 0.18
67 0.17
68 0.17
69 0.23
70 0.23
71 0.22
72 0.22
73 0.19
74 0.24
75 0.24
76 0.27
77 0.23
78 0.23
79 0.25
80 0.24
81 0.28
82 0.23
83 0.26
84 0.21
85 0.22
86 0.24
87 0.22
88 0.25
89 0.29
90 0.31
91 0.29
92 0.3
93 0.34
94 0.41
95 0.44
96 0.44
97 0.41
98 0.43
99 0.46
100 0.51
101 0.52
102 0.47
103 0.48
104 0.46
105 0.41
106 0.39
107 0.35
108 0.31
109 0.22
110 0.18
111 0.13
112 0.12
113 0.13
114 0.14
115 0.18
116 0.16
117 0.17
118 0.18
119 0.18
120 0.19
121 0.19
122 0.19
123 0.21
124 0.23
125 0.28
126 0.28
127 0.29
128 0.29
129 0.28
130 0.25
131 0.19
132 0.26
133 0.23
134 0.24
135 0.25
136 0.25
137 0.3
138 0.39
139 0.45
140 0.46
141 0.54
142 0.62
143 0.71
144 0.78
145 0.84
146 0.83
147 0.87
148 0.88
149 0.87
150 0.88
151 0.86
152 0.86
153 0.8
154 0.71
155 0.62
156 0.51
157 0.4
158 0.3
159 0.21
160 0.15
161 0.11
162 0.12
163 0.17
164 0.18
165 0.19
166 0.19
167 0.19
168 0.18
169 0.2
170 0.25
171 0.22
172 0.26
173 0.27
174 0.28
175 0.29
176 0.29
177 0.34
178 0.3
179 0.33
180 0.33
181 0.37
182 0.39
183 0.44
184 0.49
185 0.42
186 0.45
187 0.42
188 0.43
189 0.39
190 0.36
191 0.32
192 0.24
193 0.23
194 0.19
195 0.18
196 0.13
197 0.12
198 0.13
199 0.11
200 0.11
201 0.1
202 0.12
203 0.1
204 0.09
205 0.09
206 0.08
207 0.07
208 0.08
209 0.07
210 0.06
211 0.05
212 0.05
213 0.06
214 0.05
215 0.06
216 0.06
217 0.07
218 0.07
219 0.1
220 0.09
221 0.09
222 0.09
223 0.08
224 0.09
225 0.1
226 0.08
227 0.07
228 0.07
229 0.07
230 0.08
231 0.08
232 0.07
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.07
239 0.08
240 0.09
241 0.11
242 0.15
243 0.17
244 0.22
245 0.24
246 0.25
247 0.25
248 0.24
249 0.24
250 0.2
251 0.19
252 0.14
253 0.12
254 0.1
255 0.1
256 0.09
257 0.08
258 0.08
259 0.08
260 0.07
261 0.07
262 0.08
263 0.07
264 0.08
265 0.09
266 0.1
267 0.09
268 0.09
269 0.08
270 0.1
271 0.11
272 0.1
273 0.1
274 0.08
275 0.11
276 0.11
277 0.12
278 0.09
279 0.08
280 0.08
281 0.08
282 0.1
283 0.07
284 0.1
285 0.1
286 0.11
287 0.14
288 0.14
289 0.16
290 0.16
291 0.2
292 0.17
293 0.16
294 0.18
295 0.16
296 0.17
297 0.2
298 0.2
299 0.2
300 0.21
301 0.23
302 0.26
303 0.26
304 0.27
305 0.22
306 0.28
307 0.26
308 0.27
309 0.26
310 0.22
311 0.21
312 0.2
313 0.22
314 0.16
315 0.17
316 0.18
317 0.22
318 0.23
319 0.23
320 0.25
321 0.24
322 0.23
323 0.21
324 0.19
325 0.13
326 0.11
327 0.11
328 0.07
329 0.06
330 0.07
331 0.08
332 0.08
333 0.08
334 0.08
335 0.09
336 0.1
337 0.11
338 0.1
339 0.11
340 0.14
341 0.14
342 0.15
343 0.13
344 0.12
345 0.13
346 0.13
347 0.11
348 0.07
349 0.07
350 0.06
351 0.07
352 0.07
353 0.06
354 0.06
355 0.12
356 0.16
357 0.18
358 0.21
359 0.22
360 0.24
361 0.29
362 0.31
363 0.31
364 0.34
365 0.35
366 0.37
367 0.41
368 0.41
369 0.37
370 0.36
371 0.31
372 0.26
373 0.22
374 0.18
375 0.14
376 0.14
377 0.16
378 0.17
379 0.19
380 0.25