Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7G912

Protein Details
Accession A0A2G7G912   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-96PDQKKNLRRIRKKLTHCQNPDKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR031658  Cyclin_C_2  
Pfam View protein in Pfam  
PF16899  Cyclin_C_2  
CDD cd20525  CYCLIN_CCNH_rpt2  
Amino Acid Sequences MTDAYFLYTPSQIWLAAFMIADKPLAEFYLETKLGGPQEQQQGSPLYELRTKLLRTLTDCSNLLQAYKPLASDPDQKKNLRRIRKKLTHCQNPDKAGVAGQKRIPAAAAAAVAAAGDPATSESEMERLAKKRKLDGEPPKDIFGGELVTQRTKEAQQPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.11
5 0.1
6 0.1
7 0.1
8 0.1
9 0.08
10 0.08
11 0.07
12 0.08
13 0.08
14 0.07
15 0.09
16 0.16
17 0.16
18 0.15
19 0.15
20 0.17
21 0.18
22 0.19
23 0.18
24 0.17
25 0.25
26 0.26
27 0.25
28 0.25
29 0.26
30 0.26
31 0.26
32 0.21
33 0.15
34 0.18
35 0.18
36 0.18
37 0.21
38 0.2
39 0.22
40 0.24
41 0.24
42 0.25
43 0.28
44 0.28
45 0.27
46 0.28
47 0.25
48 0.24
49 0.22
50 0.18
51 0.15
52 0.13
53 0.11
54 0.11
55 0.11
56 0.08
57 0.1
58 0.12
59 0.21
60 0.25
61 0.32
62 0.37
63 0.39
64 0.44
65 0.52
66 0.57
67 0.58
68 0.63
69 0.64
70 0.69
71 0.76
72 0.79
73 0.8
74 0.83
75 0.83
76 0.81
77 0.81
78 0.76
79 0.69
80 0.62
81 0.54
82 0.43
83 0.36
84 0.34
85 0.27
86 0.25
87 0.23
88 0.24
89 0.22
90 0.22
91 0.19
92 0.14
93 0.12
94 0.1
95 0.08
96 0.05
97 0.05
98 0.05
99 0.04
100 0.04
101 0.03
102 0.02
103 0.02
104 0.02
105 0.03
106 0.05
107 0.05
108 0.05
109 0.06
110 0.07
111 0.09
112 0.11
113 0.15
114 0.2
115 0.28
116 0.32
117 0.35
118 0.41
119 0.49
120 0.54
121 0.6
122 0.65
123 0.66
124 0.71
125 0.71
126 0.66
127 0.57
128 0.5
129 0.4
130 0.3
131 0.24
132 0.16
133 0.17
134 0.18
135 0.21
136 0.21
137 0.22
138 0.24
139 0.24