Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FSG0

Protein Details
Accession A0A2G7FSG0   
Localization Confidence High
Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-100GHSCYRPRRTGERKRKSVRGABasic
177-203QRLVTPQRLQRKRHRIAIKRRRSEAARHydrophilic
218-237HEEKAKRDELRKRRASSMRKBasic
NLS Segment(s)
PositionSequence
88-95RTGERKRK
131-204KRLGPKRATKIRRFFGLDKKDDVRKFVIRRTVTKEGKPEYTKAPKIQRLVTPQRLQRKRHRIAIKRRRSEAARE
216-237RVHEEKAKRDELRKRRASSMRK
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNISYPANGSQKIIEVDDERKLRPFMEKRMGTEVVGDSLGDEFKGYLFKITGGNDKQGFPMKQGVLLPTRTRLLLADGHSCYRPRRTGERKRKSVRGAITGFDLAVLALSIVKQGEGELPGLTDTVVPKRLGPKRATKIRRFFGLDKKDDVRKFVIRRTVTKEGKPEYTKAPKIQRLVTPQRLQRKRHRIAIKRRRSEAAREAANDYAKLLANRVHEEKAKRDELRKRRASSMRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.21
4 0.21
5 0.23
6 0.3
7 0.32
8 0.29
9 0.31
10 0.31
11 0.29
12 0.36
13 0.39
14 0.41
15 0.49
16 0.51
17 0.51
18 0.57
19 0.57
20 0.47
21 0.43
22 0.35
23 0.26
24 0.22
25 0.18
26 0.11
27 0.11
28 0.11
29 0.07
30 0.07
31 0.05
32 0.05
33 0.07
34 0.07
35 0.08
36 0.08
37 0.1
38 0.13
39 0.15
40 0.22
41 0.23
42 0.28
43 0.28
44 0.29
45 0.3
46 0.34
47 0.33
48 0.27
49 0.31
50 0.26
51 0.27
52 0.27
53 0.27
54 0.24
55 0.27
56 0.26
57 0.22
58 0.23
59 0.2
60 0.19
61 0.17
62 0.16
63 0.17
64 0.18
65 0.2
66 0.2
67 0.22
68 0.23
69 0.25
70 0.24
71 0.26
72 0.28
73 0.27
74 0.36
75 0.46
76 0.56
77 0.65
78 0.73
79 0.79
80 0.81
81 0.84
82 0.78
83 0.75
84 0.68
85 0.64
86 0.55
87 0.45
88 0.4
89 0.33
90 0.27
91 0.2
92 0.15
93 0.07
94 0.05
95 0.04
96 0.02
97 0.02
98 0.02
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.07
115 0.09
116 0.09
117 0.1
118 0.19
119 0.24
120 0.29
121 0.33
122 0.41
123 0.47
124 0.57
125 0.65
126 0.66
127 0.69
128 0.67
129 0.68
130 0.64
131 0.6
132 0.6
133 0.6
134 0.54
135 0.5
136 0.5
137 0.52
138 0.47
139 0.45
140 0.4
141 0.38
142 0.39
143 0.4
144 0.44
145 0.4
146 0.45
147 0.5
148 0.55
149 0.53
150 0.54
151 0.56
152 0.51
153 0.56
154 0.53
155 0.48
156 0.46
157 0.51
158 0.52
159 0.52
160 0.57
161 0.55
162 0.57
163 0.6
164 0.57
165 0.57
166 0.62
167 0.64
168 0.62
169 0.63
170 0.7
171 0.72
172 0.73
173 0.75
174 0.76
175 0.74
176 0.77
177 0.81
178 0.8
179 0.84
180 0.88
181 0.88
182 0.86
183 0.83
184 0.81
185 0.74
186 0.73
187 0.7
188 0.67
189 0.61
190 0.54
191 0.52
192 0.49
193 0.46
194 0.38
195 0.29
196 0.23
197 0.21
198 0.19
199 0.18
200 0.18
201 0.21
202 0.26
203 0.29
204 0.31
205 0.35
206 0.4
207 0.46
208 0.5
209 0.54
210 0.54
211 0.6
212 0.66
213 0.7
214 0.77
215 0.78
216 0.76
217 0.77