Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7G2X2

Protein Details
Accession A0A2G7G2X2   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-62GMGRPQRARLREENKRRLRKSQNGSAAPKVHydrophilic
NLS Segment(s)
PositionSequence
34-70MGRPQRARLREENKRRLRKSQNGSAAPKVIVKKEPPS
80-81PR
Subcellular Location(s) nucl 13, mito 11, cyto 1, plas 1, extr 1
Family & Domain DBs
Amino Acid Sequences MNRDPSPKIAQRWHPQLVASLPPLHPGLRGLPGMGRPQRARLREENKRRLRKSQNGSAAPKVIVKKEPPSSPAMQSHSRPRPRKLDLSTSLPTSGGLSARPPGGPMTAREGVNMHQVGIACLSPGFQTHDPIMREQLQRSLSVRDQQRSIIESRLQRSAKDDGPDGIKPSESSFGLPKASASKRRPPPGLSIVPPSAAQFANERVIQSAPLNQTFTSRHQPQPLTRQVANQSPTLGSTSHLHHISVTQTNNRLPPLSDVFGSDALGSREQNANRAPFYQNASNSNSSQSNNLPPLPSPRIPGTATQVPKRPREYRSAEEAVQELSGGREDLLPRIVHYGGHQPPTPPSPRAVNGQPKSAAVHPEAAPVPNAQVPPSQTMYPSERTARRRTRSEYEQDNGSPPLGHGPEPHYRQNPALAPGAGASYGPFGAGRDSPETQRRKKEEFLALCARAWDLFHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.6
3 0.57
4 0.51
5 0.47
6 0.4
7 0.36
8 0.3
9 0.31
10 0.32
11 0.28
12 0.25
13 0.22
14 0.22
15 0.21
16 0.22
17 0.2
18 0.21
19 0.25
20 0.33
21 0.36
22 0.4
23 0.37
24 0.46
25 0.53
26 0.54
27 0.58
28 0.59
29 0.64
30 0.68
31 0.77
32 0.79
33 0.82
34 0.88
35 0.86
36 0.86
37 0.87
38 0.86
39 0.85
40 0.84
41 0.83
42 0.81
43 0.81
44 0.75
45 0.68
46 0.58
47 0.54
48 0.47
49 0.41
50 0.38
51 0.37
52 0.41
53 0.44
54 0.47
55 0.45
56 0.48
57 0.47
58 0.48
59 0.5
60 0.48
61 0.46
62 0.47
63 0.55
64 0.59
65 0.65
66 0.65
67 0.67
68 0.71
69 0.72
70 0.76
71 0.72
72 0.72
73 0.67
74 0.68
75 0.63
76 0.56
77 0.49
78 0.4
79 0.33
80 0.24
81 0.21
82 0.14
83 0.12
84 0.11
85 0.12
86 0.14
87 0.13
88 0.13
89 0.12
90 0.15
91 0.16
92 0.16
93 0.21
94 0.25
95 0.25
96 0.25
97 0.25
98 0.23
99 0.28
100 0.27
101 0.19
102 0.16
103 0.17
104 0.16
105 0.16
106 0.15
107 0.08
108 0.07
109 0.08
110 0.06
111 0.07
112 0.12
113 0.12
114 0.14
115 0.16
116 0.22
117 0.23
118 0.24
119 0.27
120 0.28
121 0.3
122 0.29
123 0.33
124 0.29
125 0.3
126 0.3
127 0.31
128 0.26
129 0.31
130 0.36
131 0.33
132 0.33
133 0.33
134 0.33
135 0.31
136 0.31
137 0.28
138 0.27
139 0.29
140 0.3
141 0.36
142 0.35
143 0.32
144 0.34
145 0.35
146 0.33
147 0.3
148 0.29
149 0.23
150 0.26
151 0.26
152 0.25
153 0.21
154 0.18
155 0.16
156 0.16
157 0.17
158 0.13
159 0.14
160 0.13
161 0.14
162 0.15
163 0.14
164 0.14
165 0.18
166 0.23
167 0.3
168 0.34
169 0.42
170 0.49
171 0.56
172 0.58
173 0.54
174 0.56
175 0.55
176 0.54
177 0.46
178 0.43
179 0.37
180 0.34
181 0.32
182 0.26
183 0.2
184 0.15
185 0.13
186 0.1
187 0.11
188 0.13
189 0.13
190 0.13
191 0.12
192 0.12
193 0.12
194 0.11
195 0.14
196 0.14
197 0.14
198 0.15
199 0.14
200 0.17
201 0.18
202 0.22
203 0.25
204 0.27
205 0.29
206 0.33
207 0.36
208 0.38
209 0.45
210 0.48
211 0.45
212 0.42
213 0.42
214 0.4
215 0.42
216 0.4
217 0.31
218 0.25
219 0.19
220 0.19
221 0.17
222 0.14
223 0.1
224 0.1
225 0.12
226 0.15
227 0.15
228 0.14
229 0.13
230 0.14
231 0.16
232 0.18
233 0.18
234 0.17
235 0.19
236 0.21
237 0.22
238 0.22
239 0.2
240 0.16
241 0.18
242 0.19
243 0.17
244 0.16
245 0.15
246 0.16
247 0.15
248 0.15
249 0.11
250 0.09
251 0.09
252 0.1
253 0.09
254 0.1
255 0.14
256 0.14
257 0.17
258 0.19
259 0.2
260 0.2
261 0.23
262 0.22
263 0.21
264 0.25
265 0.26
266 0.25
267 0.27
268 0.31
269 0.31
270 0.3
271 0.3
272 0.28
273 0.24
274 0.24
275 0.23
276 0.23
277 0.23
278 0.23
279 0.21
280 0.2
281 0.26
282 0.29
283 0.28
284 0.27
285 0.26
286 0.29
287 0.29
288 0.3
289 0.3
290 0.31
291 0.34
292 0.35
293 0.4
294 0.41
295 0.46
296 0.52
297 0.52
298 0.48
299 0.53
300 0.57
301 0.55
302 0.58
303 0.56
304 0.49
305 0.44
306 0.42
307 0.33
308 0.25
309 0.2
310 0.12
311 0.08
312 0.07
313 0.06
314 0.06
315 0.07
316 0.08
317 0.1
318 0.13
319 0.12
320 0.13
321 0.15
322 0.15
323 0.13
324 0.15
325 0.23
326 0.24
327 0.27
328 0.28
329 0.26
330 0.29
331 0.35
332 0.38
333 0.3
334 0.29
335 0.3
336 0.32
337 0.36
338 0.42
339 0.46
340 0.44
341 0.48
342 0.46
343 0.42
344 0.42
345 0.39
346 0.34
347 0.25
348 0.28
349 0.23
350 0.26
351 0.27
352 0.24
353 0.23
354 0.19
355 0.2
356 0.18
357 0.18
358 0.14
359 0.16
360 0.18
361 0.21
362 0.24
363 0.23
364 0.2
365 0.25
366 0.29
367 0.3
368 0.32
369 0.35
370 0.39
371 0.45
372 0.55
373 0.6
374 0.63
375 0.67
376 0.71
377 0.72
378 0.74
379 0.76
380 0.74
381 0.67
382 0.65
383 0.59
384 0.55
385 0.47
386 0.38
387 0.3
388 0.22
389 0.25
390 0.21
391 0.2
392 0.2
393 0.24
394 0.32
395 0.37
396 0.45
397 0.42
398 0.43
399 0.44
400 0.48
401 0.47
402 0.42
403 0.41
404 0.33
405 0.29
406 0.27
407 0.26
408 0.19
409 0.15
410 0.11
411 0.08
412 0.08
413 0.08
414 0.07
415 0.07
416 0.1
417 0.12
418 0.15
419 0.19
420 0.22
421 0.29
422 0.38
423 0.47
424 0.52
425 0.61
426 0.66
427 0.67
428 0.71
429 0.73
430 0.75
431 0.7
432 0.7
433 0.69
434 0.63
435 0.57
436 0.51
437 0.43
438 0.33