Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7GA01

Protein Details
Accession A0A2G7GA01   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-108ELLAGGKKDKKKENGNKGGKBasic
NLS Segment(s)
PositionSequence
93-108GGKKDKKKENGNKGGK
Subcellular Location(s) mito 20.5, cyto_mito 11.833, cyto_nucl 2.833, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGSLKKKAGTGPKRYATFLLYKSFFIANNSEGILLWEPRALGPKPGPRQIAPKKQSLIKQQKMTKKLTAGLISKTERNLAQKAGHLELLAGGKKDKKKENGNKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.64
4 0.59
5 0.51
6 0.48
7 0.42
8 0.39
9 0.33
10 0.3
11 0.3
12 0.3
13 0.27
14 0.23
15 0.22
16 0.15
17 0.15
18 0.15
19 0.13
20 0.12
21 0.13
22 0.12
23 0.1
24 0.09
25 0.08
26 0.08
27 0.08
28 0.13
29 0.11
30 0.13
31 0.18
32 0.26
33 0.3
34 0.34
35 0.36
36 0.34
37 0.43
38 0.49
39 0.55
40 0.5
41 0.5
42 0.48
43 0.49
44 0.54
45 0.54
46 0.56
47 0.53
48 0.58
49 0.6
50 0.65
51 0.66
52 0.65
53 0.58
54 0.5
55 0.46
56 0.42
57 0.4
58 0.35
59 0.32
60 0.33
61 0.32
62 0.31
63 0.28
64 0.27
65 0.24
66 0.26
67 0.26
68 0.24
69 0.24
70 0.26
71 0.29
72 0.29
73 0.27
74 0.23
75 0.2
76 0.19
77 0.2
78 0.18
79 0.15
80 0.16
81 0.22
82 0.27
83 0.35
84 0.41
85 0.47
86 0.57
87 0.67
88 0.76