Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MRH5

Protein Details
Accession B8MRH5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
200-226KLDVEESRPQKKKKKTTTAGNNNENKFHydrophilic
NLS Segment(s)
PositionSequence
210-213KKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MAKRKSLKDNDNDVSMTDRRDDDSGSDSDVELVNVEFEWFDPQPAVDFHGLKTLLRQLFDNDAQLFDISALADLILSQPLLGSTVKVDGNETDPYAFLSVLNINEHKDKPVIKDLTKYIAQKSSSNPSLASLARLLANPENPPAIGLILTERLINIPAEVVPPMYSMLLEEISWALEEKEPYNFTHYLILSKTYEEVESKLDVEESRPQKKKKKTTTAGNNNENKFYFHPEDEVFERHTLCHGTFEYTHKQAEGASDSKRAFQDFGIKPAGSLMLIEEGKFGNAVKAITEYLKPPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.33
4 0.26
5 0.24
6 0.22
7 0.23
8 0.23
9 0.2
10 0.22
11 0.21
12 0.21
13 0.2
14 0.18
15 0.18
16 0.17
17 0.15
18 0.11
19 0.1
20 0.08
21 0.07
22 0.07
23 0.06
24 0.06
25 0.11
26 0.1
27 0.11
28 0.11
29 0.11
30 0.13
31 0.13
32 0.17
33 0.15
34 0.16
35 0.16
36 0.22
37 0.22
38 0.2
39 0.22
40 0.27
41 0.25
42 0.25
43 0.25
44 0.22
45 0.28
46 0.29
47 0.3
48 0.22
49 0.21
50 0.21
51 0.2
52 0.17
53 0.11
54 0.1
55 0.06
56 0.06
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.06
68 0.06
69 0.05
70 0.06
71 0.09
72 0.1
73 0.1
74 0.11
75 0.1
76 0.13
77 0.14
78 0.14
79 0.11
80 0.11
81 0.11
82 0.11
83 0.1
84 0.07
85 0.07
86 0.08
87 0.09
88 0.11
89 0.11
90 0.12
91 0.16
92 0.16
93 0.16
94 0.18
95 0.19
96 0.2
97 0.29
98 0.32
99 0.29
100 0.33
101 0.33
102 0.35
103 0.37
104 0.35
105 0.29
106 0.3
107 0.3
108 0.28
109 0.3
110 0.32
111 0.3
112 0.29
113 0.27
114 0.22
115 0.24
116 0.21
117 0.19
118 0.12
119 0.11
120 0.11
121 0.11
122 0.11
123 0.1
124 0.11
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.08
131 0.07
132 0.05
133 0.05
134 0.04
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.06
141 0.06
142 0.05
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.06
164 0.07
165 0.07
166 0.1
167 0.11
168 0.12
169 0.16
170 0.16
171 0.16
172 0.19
173 0.19
174 0.18
175 0.18
176 0.2
177 0.16
178 0.16
179 0.16
180 0.12
181 0.13
182 0.12
183 0.12
184 0.11
185 0.12
186 0.12
187 0.11
188 0.11
189 0.1
190 0.12
191 0.19
192 0.24
193 0.33
194 0.4
195 0.47
196 0.55
197 0.65
198 0.73
199 0.76
200 0.81
201 0.8
202 0.84
203 0.88
204 0.9
205 0.89
206 0.88
207 0.85
208 0.76
209 0.7
210 0.6
211 0.52
212 0.42
213 0.4
214 0.34
215 0.27
216 0.29
217 0.27
218 0.3
219 0.3
220 0.3
221 0.26
222 0.23
223 0.23
224 0.19
225 0.21
226 0.19
227 0.17
228 0.18
229 0.17
230 0.19
231 0.21
232 0.26
233 0.31
234 0.32
235 0.32
236 0.28
237 0.27
238 0.24
239 0.25
240 0.25
241 0.21
242 0.21
243 0.26
244 0.27
245 0.3
246 0.31
247 0.3
248 0.26
249 0.24
250 0.32
251 0.29
252 0.33
253 0.34
254 0.32
255 0.3
256 0.3
257 0.29
258 0.19
259 0.16
260 0.12
261 0.14
262 0.14
263 0.14
264 0.14
265 0.14
266 0.14
267 0.15
268 0.14
269 0.09
270 0.11
271 0.11
272 0.11
273 0.13
274 0.14
275 0.17
276 0.18