Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MAR7

Protein Details
Accession B8MAR7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
243-265APAMSFAKARKPKKPFNAGLGIKHydrophilic
NLS Segment(s)
PositionSequence
250-267KARKPKKPFNAGLGIKKK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
IPR043701  Yju2  
Gene Ontology GO:0071006  C:U2-type catalytic step 1 spliceosome  
GO:0046872  F:metal ion binding  
GO:0000349  P:generation of catalytic spliceosome for first transesterification step  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MSERKVLTKYYPPDFDPSAITRTKKVPGVKQKLLTVRLMAPFSMRCTSCGEYIYKGRKFNARKETTEEKYLSIAIYRFYIRCTRCSGEITFKTDPKNMDYVCERGAKRNFEPWRNTQADNLNETEEETLDRLEREENEELEQLERDKMAELEEKMLDSKREMAVADALDEIRTRNARIERGEALGEDVALAYVKDEAEEARLRAEKEDEEIARRAFMTSTGQKVKRLVEDEEETAAKTAETPAPAMSFAKARKPKKPFNAGLGIKKKASLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.41
4 0.37
5 0.35
6 0.36
7 0.35
8 0.33
9 0.35
10 0.39
11 0.4
12 0.44
13 0.49
14 0.56
15 0.63
16 0.67
17 0.68
18 0.7
19 0.71
20 0.67
21 0.59
22 0.51
23 0.46
24 0.42
25 0.38
26 0.31
27 0.26
28 0.24
29 0.26
30 0.28
31 0.24
32 0.21
33 0.26
34 0.28
35 0.28
36 0.29
37 0.27
38 0.26
39 0.34
40 0.41
41 0.4
42 0.41
43 0.42
44 0.49
45 0.53
46 0.58
47 0.6
48 0.58
49 0.56
50 0.61
51 0.66
52 0.62
53 0.62
54 0.54
55 0.44
56 0.39
57 0.36
58 0.28
59 0.22
60 0.18
61 0.12
62 0.13
63 0.14
64 0.13
65 0.15
66 0.22
67 0.21
68 0.23
69 0.28
70 0.29
71 0.3
72 0.33
73 0.33
74 0.36
75 0.38
76 0.41
77 0.39
78 0.39
79 0.39
80 0.39
81 0.38
82 0.31
83 0.33
84 0.26
85 0.26
86 0.26
87 0.25
88 0.25
89 0.3
90 0.27
91 0.3
92 0.35
93 0.36
94 0.35
95 0.42
96 0.45
97 0.45
98 0.5
99 0.48
100 0.52
101 0.5
102 0.49
103 0.44
104 0.45
105 0.41
106 0.37
107 0.33
108 0.25
109 0.21
110 0.21
111 0.17
112 0.11
113 0.08
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.07
121 0.11
122 0.12
123 0.12
124 0.13
125 0.14
126 0.14
127 0.13
128 0.13
129 0.09
130 0.08
131 0.08
132 0.06
133 0.06
134 0.06
135 0.07
136 0.1
137 0.1
138 0.11
139 0.12
140 0.12
141 0.12
142 0.13
143 0.12
144 0.1
145 0.12
146 0.1
147 0.11
148 0.11
149 0.11
150 0.12
151 0.11
152 0.11
153 0.08
154 0.08
155 0.07
156 0.08
157 0.07
158 0.08
159 0.09
160 0.09
161 0.14
162 0.17
163 0.21
164 0.23
165 0.27
166 0.26
167 0.26
168 0.26
169 0.21
170 0.19
171 0.15
172 0.13
173 0.09
174 0.07
175 0.05
176 0.05
177 0.04
178 0.03
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.08
185 0.1
186 0.11
187 0.14
188 0.16
189 0.17
190 0.18
191 0.2
192 0.17
193 0.18
194 0.24
195 0.21
196 0.23
197 0.25
198 0.24
199 0.22
200 0.22
201 0.2
202 0.14
203 0.15
204 0.18
205 0.2
206 0.27
207 0.35
208 0.36
209 0.39
210 0.42
211 0.44
212 0.43
213 0.43
214 0.38
215 0.36
216 0.38
217 0.37
218 0.37
219 0.33
220 0.27
221 0.24
222 0.21
223 0.15
224 0.11
225 0.13
226 0.12
227 0.13
228 0.13
229 0.14
230 0.15
231 0.16
232 0.17
233 0.15
234 0.18
235 0.2
236 0.29
237 0.37
238 0.43
239 0.51
240 0.6
241 0.69
242 0.73
243 0.81
244 0.78
245 0.76
246 0.81
247 0.78
248 0.8
249 0.77
250 0.71
251 0.61