Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MSX0

Protein Details
Accession B8MSX0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
136-165NEHCEGRNEKDKRRNWKGYRLKGKLSRVRIBasic
NLS Segment(s)
PositionSequence
145-164KDKRRNWKGYRLKGKLSRVR
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MRESKGGIDWWRYQKEVLIPKLIPFARDCMMERPNTIILEDGAPAHRHHYQQLVHDKYHVQKMLDWPGNSPDLNAIEPTWIWLKRRTTVRGAPRDKKTAKVAWIKAWNDLPQKQIQDWIERLIRHVQEVIRLEGGNEHCEGRNEKDKRRNWKGYRLKGKLSRVRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.49
4 0.45
5 0.42
6 0.39
7 0.39
8 0.47
9 0.43
10 0.36
11 0.29
12 0.28
13 0.24
14 0.26
15 0.27
16 0.25
17 0.28
18 0.28
19 0.28
20 0.28
21 0.28
22 0.26
23 0.24
24 0.18
25 0.15
26 0.15
27 0.14
28 0.11
29 0.1
30 0.11
31 0.11
32 0.14
33 0.17
34 0.17
35 0.19
36 0.24
37 0.24
38 0.31
39 0.41
40 0.41
41 0.38
42 0.39
43 0.4
44 0.37
45 0.41
46 0.35
47 0.25
48 0.24
49 0.29
50 0.36
51 0.37
52 0.34
53 0.29
54 0.29
55 0.31
56 0.28
57 0.23
58 0.16
59 0.12
60 0.13
61 0.12
62 0.09
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.11
69 0.16
70 0.18
71 0.24
72 0.3
73 0.32
74 0.34
75 0.4
76 0.48
77 0.53
78 0.59
79 0.62
80 0.61
81 0.66
82 0.62
83 0.59
84 0.55
85 0.49
86 0.49
87 0.49
88 0.47
89 0.45
90 0.52
91 0.48
92 0.46
93 0.45
94 0.42
95 0.39
96 0.39
97 0.35
98 0.32
99 0.33
100 0.3
101 0.33
102 0.3
103 0.29
104 0.29
105 0.3
106 0.29
107 0.27
108 0.3
109 0.31
110 0.29
111 0.25
112 0.27
113 0.23
114 0.26
115 0.28
116 0.28
117 0.23
118 0.22
119 0.21
120 0.23
121 0.24
122 0.2
123 0.18
124 0.18
125 0.17
126 0.21
127 0.24
128 0.25
129 0.34
130 0.38
131 0.47
132 0.55
133 0.62
134 0.7
135 0.77
136 0.81
137 0.78
138 0.84
139 0.85
140 0.86
141 0.89
142 0.86
143 0.85
144 0.83
145 0.86