Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FYE7

Protein Details
Accession A0A2G7FYE7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-81DGPPKYRQAKSARMKKKKPVERARPPPVGERBasic
NLS Segment(s)
PositionSequence
45-87KKKNSLDGPPKYRQAKSARMKKKKPVERARPPPVGERKALRKR
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MVSSFCWGCLTRLRPTPRAVLPPTVAAPRAAAFHTSTVRYALPTKKKNSLDGPPKYRQAKSARMKKKKPVERARPPPVGERKALRKRIVLSNPNALEVEGMQDFTSETMVDARLRGSILGLPVPMLTQLRAVEAFKPKQGWSIFRRPGTVVRRETLELGRLIDSISNEGQDKGKSVKKIVTGVRGSGKTVHLLQAMAMAFIKQWVVFTVPEPQDLVIAHTGYAPLSDETPNLYVQNEATATLLSRTVAANEQVLKTLHVSREHVALKSSVKAGMTLEELAKLGIQDPAIAWTVFQALWAELTATSPASGFDKNFKPRPPMLVTVDGLSHWMKNSEYRSVEFEPIHAHDLVFVRHFLGLLKPGTGKPALPNGGLLLYSTSASNNPTIYSFEVALKQIAARQAGLNASAPEFPQADPYSGADKRVIDAFDSSKPTAAKEGMLELQTLGGLTRDEARGFMEYFARSGLLREKINDEWVGEKWSLAGGGVIGELEKLGRRLRVTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.61
4 0.59
5 0.63
6 0.59
7 0.57
8 0.52
9 0.5
10 0.49
11 0.44
12 0.38
13 0.3
14 0.27
15 0.21
16 0.22
17 0.19
18 0.18
19 0.16
20 0.19
21 0.23
22 0.23
23 0.23
24 0.23
25 0.23
26 0.23
27 0.29
28 0.34
29 0.4
30 0.47
31 0.53
32 0.6
33 0.63
34 0.67
35 0.68
36 0.69
37 0.69
38 0.71
39 0.73
40 0.71
41 0.76
42 0.75
43 0.69
44 0.67
45 0.65
46 0.65
47 0.67
48 0.71
49 0.73
50 0.78
51 0.85
52 0.86
53 0.89
54 0.88
55 0.89
56 0.89
57 0.89
58 0.89
59 0.92
60 0.91
61 0.88
62 0.81
63 0.8
64 0.78
65 0.72
66 0.66
67 0.63
68 0.65
69 0.67
70 0.73
71 0.67
72 0.63
73 0.63
74 0.68
75 0.7
76 0.68
77 0.62
78 0.63
79 0.6
80 0.55
81 0.5
82 0.4
83 0.3
84 0.22
85 0.2
86 0.11
87 0.1
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.05
94 0.05
95 0.06
96 0.08
97 0.09
98 0.09
99 0.09
100 0.1
101 0.1
102 0.09
103 0.09
104 0.09
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.1
112 0.09
113 0.08
114 0.09
115 0.09
116 0.1
117 0.12
118 0.13
119 0.17
120 0.24
121 0.26
122 0.26
123 0.28
124 0.27
125 0.33
126 0.34
127 0.36
128 0.36
129 0.45
130 0.49
131 0.48
132 0.5
133 0.45
134 0.51
135 0.51
136 0.52
137 0.45
138 0.4
139 0.41
140 0.4
141 0.41
142 0.34
143 0.3
144 0.22
145 0.2
146 0.19
147 0.16
148 0.15
149 0.14
150 0.12
151 0.12
152 0.11
153 0.11
154 0.11
155 0.12
156 0.13
157 0.12
158 0.14
159 0.16
160 0.2
161 0.21
162 0.22
163 0.25
164 0.27
165 0.33
166 0.35
167 0.38
168 0.35
169 0.36
170 0.39
171 0.36
172 0.33
173 0.29
174 0.27
175 0.2
176 0.2
177 0.19
178 0.14
179 0.14
180 0.13
181 0.14
182 0.13
183 0.11
184 0.1
185 0.08
186 0.07
187 0.08
188 0.08
189 0.04
190 0.04
191 0.05
192 0.06
193 0.07
194 0.08
195 0.16
196 0.16
197 0.16
198 0.17
199 0.16
200 0.15
201 0.15
202 0.16
203 0.09
204 0.08
205 0.08
206 0.08
207 0.08
208 0.07
209 0.07
210 0.06
211 0.05
212 0.06
213 0.06
214 0.06
215 0.08
216 0.09
217 0.1
218 0.09
219 0.09
220 0.08
221 0.07
222 0.09
223 0.07
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.06
234 0.07
235 0.07
236 0.08
237 0.09
238 0.09
239 0.1
240 0.1
241 0.1
242 0.11
243 0.13
244 0.14
245 0.15
246 0.17
247 0.16
248 0.22
249 0.22
250 0.21
251 0.19
252 0.18
253 0.18
254 0.17
255 0.17
256 0.12
257 0.11
258 0.11
259 0.1
260 0.1
261 0.1
262 0.09
263 0.09
264 0.08
265 0.08
266 0.07
267 0.07
268 0.06
269 0.05
270 0.06
271 0.05
272 0.05
273 0.05
274 0.07
275 0.08
276 0.08
277 0.07
278 0.06
279 0.08
280 0.07
281 0.07
282 0.06
283 0.05
284 0.05
285 0.06
286 0.06
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.07
295 0.08
296 0.08
297 0.14
298 0.21
299 0.27
300 0.32
301 0.35
302 0.39
303 0.4
304 0.46
305 0.44
306 0.43
307 0.41
308 0.4
309 0.38
310 0.32
311 0.31
312 0.24
313 0.22
314 0.17
315 0.13
316 0.09
317 0.09
318 0.09
319 0.14
320 0.16
321 0.2
322 0.22
323 0.23
324 0.28
325 0.3
326 0.33
327 0.29
328 0.27
329 0.24
330 0.24
331 0.25
332 0.19
333 0.16
334 0.16
335 0.17
336 0.17
337 0.15
338 0.13
339 0.11
340 0.11
341 0.12
342 0.09
343 0.1
344 0.13
345 0.12
346 0.13
347 0.14
348 0.15
349 0.18
350 0.18
351 0.17
352 0.16
353 0.23
354 0.23
355 0.22
356 0.22
357 0.2
358 0.19
359 0.18
360 0.15
361 0.09
362 0.07
363 0.08
364 0.08
365 0.07
366 0.08
367 0.1
368 0.11
369 0.1
370 0.1
371 0.11
372 0.13
373 0.14
374 0.15
375 0.14
376 0.15
377 0.17
378 0.17
379 0.16
380 0.15
381 0.13
382 0.14
383 0.16
384 0.15
385 0.14
386 0.14
387 0.15
388 0.16
389 0.16
390 0.15
391 0.13
392 0.14
393 0.13
394 0.13
395 0.13
396 0.14
397 0.13
398 0.18
399 0.18
400 0.18
401 0.19
402 0.21
403 0.25
404 0.25
405 0.26
406 0.23
407 0.22
408 0.22
409 0.24
410 0.23
411 0.17
412 0.2
413 0.21
414 0.23
415 0.28
416 0.27
417 0.27
418 0.27
419 0.27
420 0.28
421 0.26
422 0.22
423 0.18
424 0.21
425 0.21
426 0.22
427 0.21
428 0.16
429 0.15
430 0.14
431 0.12
432 0.09
433 0.06
434 0.06
435 0.06
436 0.1
437 0.12
438 0.12
439 0.13
440 0.15
441 0.17
442 0.17
443 0.18
444 0.19
445 0.18
446 0.18
447 0.18
448 0.17
449 0.14
450 0.16
451 0.21
452 0.23
453 0.24
454 0.27
455 0.31
456 0.32
457 0.37
458 0.36
459 0.3
460 0.27
461 0.27
462 0.28
463 0.24
464 0.21
465 0.17
466 0.16
467 0.15
468 0.12
469 0.1
470 0.06
471 0.06
472 0.06
473 0.06
474 0.05
475 0.05
476 0.05
477 0.06
478 0.08
479 0.11
480 0.14
481 0.19