Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FKY3

Protein Details
Accession A0A2G7FKY3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-49GSRSEGSTSRAKRRKQRGGAEWEVSRHydrophilic
NLS Segment(s)
PositionSequence
34-39AKRRKQ
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007198  Ssl1-like  
IPR012170  TFIIH_SSL1/p44  
IPR002035  VWF_A  
IPR036465  vWFA_dom_sf  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0006351  P:DNA-templated transcription  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF04056  Ssl1  
PROSITE View protein in PROSITE  
PS50234  VWFA  
CDD cd01453  vWA_transcription_factor_IIH_type  
Amino Acid Sequences MGDSDEEYIGEVSEDEDDNNVFLGSRSEGSTSRAKRRKQRGGAEWEVSRTWETLVEGADGTISSTVEGLLEAGKRKRLLKDTTPLQRGIIRHLILIIDLSQSMTEKDLRPTRYLLTLRYAQELVREFFEQNPISQLGVLGLRDGLAIRISDLSGNPTEHISAIQTLRDQDPKGLPSLQNGVEMARGALFHTPSHGTREIFIIFGSLLSSDPGDIHQTIANLINDKVRVGIVGLAAQVAICRELCAKTNGGDDTRYGVALNEQHFRELLMDVTTPPATYSQKQSASSLLMMGFPSRTVETSASLCASKFVVSLQSAPLAASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.09
6 0.1
7 0.09
8 0.07
9 0.07
10 0.09
11 0.1
12 0.11
13 0.12
14 0.14
15 0.15
16 0.19
17 0.28
18 0.33
19 0.42
20 0.49
21 0.56
22 0.64
23 0.74
24 0.81
25 0.82
26 0.85
27 0.84
28 0.85
29 0.85
30 0.8
31 0.71
32 0.63
33 0.54
34 0.45
35 0.36
36 0.27
37 0.2
38 0.16
39 0.14
40 0.13
41 0.13
42 0.12
43 0.11
44 0.11
45 0.1
46 0.08
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.06
57 0.08
58 0.13
59 0.15
60 0.19
61 0.22
62 0.26
63 0.32
64 0.38
65 0.43
66 0.46
67 0.53
68 0.58
69 0.65
70 0.64
71 0.59
72 0.53
73 0.5
74 0.43
75 0.39
76 0.37
77 0.28
78 0.24
79 0.24
80 0.22
81 0.18
82 0.18
83 0.12
84 0.06
85 0.06
86 0.06
87 0.05
88 0.06
89 0.06
90 0.07
91 0.1
92 0.11
93 0.17
94 0.23
95 0.26
96 0.27
97 0.29
98 0.29
99 0.34
100 0.34
101 0.29
102 0.28
103 0.31
104 0.3
105 0.31
106 0.29
107 0.22
108 0.24
109 0.25
110 0.21
111 0.18
112 0.18
113 0.16
114 0.16
115 0.21
116 0.18
117 0.16
118 0.17
119 0.15
120 0.14
121 0.13
122 0.12
123 0.08
124 0.08
125 0.08
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.05
139 0.07
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.08
151 0.08
152 0.09
153 0.11
154 0.13
155 0.13
156 0.14
157 0.15
158 0.16
159 0.17
160 0.18
161 0.16
162 0.16
163 0.19
164 0.18
165 0.16
166 0.15
167 0.14
168 0.12
169 0.11
170 0.1
171 0.06
172 0.05
173 0.05
174 0.06
175 0.07
176 0.06
177 0.09
178 0.11
179 0.11
180 0.16
181 0.18
182 0.17
183 0.17
184 0.2
185 0.18
186 0.16
187 0.15
188 0.1
189 0.08
190 0.07
191 0.07
192 0.05
193 0.04
194 0.05
195 0.05
196 0.04
197 0.05
198 0.05
199 0.08
200 0.08
201 0.08
202 0.09
203 0.09
204 0.1
205 0.14
206 0.14
207 0.13
208 0.13
209 0.15
210 0.14
211 0.14
212 0.13
213 0.1
214 0.09
215 0.08
216 0.09
217 0.07
218 0.07
219 0.07
220 0.06
221 0.06
222 0.06
223 0.06
224 0.05
225 0.05
226 0.04
227 0.05
228 0.07
229 0.09
230 0.11
231 0.14
232 0.15
233 0.16
234 0.2
235 0.21
236 0.21
237 0.21
238 0.19
239 0.2
240 0.19
241 0.18
242 0.14
243 0.12
244 0.14
245 0.17
246 0.19
247 0.21
248 0.21
249 0.22
250 0.21
251 0.22
252 0.2
253 0.16
254 0.14
255 0.1
256 0.11
257 0.1
258 0.14
259 0.13
260 0.12
261 0.12
262 0.15
263 0.17
264 0.2
265 0.27
266 0.32
267 0.37
268 0.38
269 0.39
270 0.38
271 0.37
272 0.34
273 0.29
274 0.21
275 0.17
276 0.16
277 0.16
278 0.13
279 0.1
280 0.13
281 0.12
282 0.13
283 0.14
284 0.15
285 0.17
286 0.19
287 0.2
288 0.2
289 0.19
290 0.18
291 0.17
292 0.16
293 0.14
294 0.12
295 0.12
296 0.15
297 0.16
298 0.18
299 0.18
300 0.19
301 0.19