Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FP58

Protein Details
Accession A0A2G7FP58    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
176-208GRGMIRRGRGRVFRKKRGKKKTKPKSILEMDVEBasic
NLS Segment(s)
PositionSequence
174-200KRGRGMIRRGRGRVFRKKRGKKKTKPK
Subcellular Location(s) nucl 17, plas 4, pero 2, mito 1, cyto 1, golg 1, vacu 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKAWNFFDGDHHTETNILSTSFKDTDVDIDITKTSQHPLTLNQPSEDPDYTSSNPNSNSNSHHNIDNNNNININSLDNNNPNNNNNPTTHGTFLTSPNTAPISQPLPPSTTKRYLRVLHQTQLPTNFLKNHMHEIVVVGLFLLIPVTLALVEIIEKIGLGVDEGVELEDYLELKRGRGMIRRGRGRVFRKKRGKKKTKPKSILEMDVEDQAFLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.19
4 0.15
5 0.12
6 0.13
7 0.18
8 0.18
9 0.18
10 0.16
11 0.15
12 0.17
13 0.2
14 0.21
15 0.16
16 0.16
17 0.16
18 0.15
19 0.16
20 0.15
21 0.14
22 0.14
23 0.15
24 0.16
25 0.19
26 0.28
27 0.35
28 0.36
29 0.34
30 0.33
31 0.34
32 0.36
33 0.33
34 0.26
35 0.21
36 0.24
37 0.25
38 0.29
39 0.28
40 0.27
41 0.29
42 0.3
43 0.3
44 0.27
45 0.3
46 0.32
47 0.36
48 0.34
49 0.35
50 0.35
51 0.36
52 0.39
53 0.42
54 0.39
55 0.34
56 0.33
57 0.3
58 0.29
59 0.25
60 0.21
61 0.14
62 0.13
63 0.14
64 0.16
65 0.19
66 0.2
67 0.22
68 0.23
69 0.26
70 0.28
71 0.27
72 0.25
73 0.28
74 0.29
75 0.28
76 0.28
77 0.23
78 0.22
79 0.21
80 0.22
81 0.2
82 0.16
83 0.14
84 0.14
85 0.15
86 0.13
87 0.12
88 0.12
89 0.12
90 0.13
91 0.15
92 0.14
93 0.15
94 0.17
95 0.21
96 0.24
97 0.3
98 0.31
99 0.33
100 0.39
101 0.39
102 0.42
103 0.48
104 0.47
105 0.43
106 0.45
107 0.42
108 0.38
109 0.38
110 0.35
111 0.26
112 0.24
113 0.21
114 0.2
115 0.23
116 0.22
117 0.25
118 0.23
119 0.23
120 0.21
121 0.2
122 0.18
123 0.14
124 0.12
125 0.06
126 0.06
127 0.05
128 0.05
129 0.04
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.11
159 0.1
160 0.11
161 0.13
162 0.16
163 0.19
164 0.27
165 0.36
166 0.4
167 0.5
168 0.58
169 0.61
170 0.65
171 0.71
172 0.73
173 0.76
174 0.76
175 0.77
176 0.8
177 0.87
178 0.91
179 0.93
180 0.94
181 0.94
182 0.95
183 0.95
184 0.95
185 0.94
186 0.91
187 0.9
188 0.87
189 0.84
190 0.77
191 0.71
192 0.61
193 0.57
194 0.49