Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FNY2

Protein Details
Accession A0A2G7FNY2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
223-251GPLWMLPKAERRKLRRKFRGTQGLCRDRWHydrophilic
NLS Segment(s)
PositionSequence
230-240KAERRKLRRKF
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, pero 7, nucl 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022085  OpdG  
Pfam View protein in Pfam  
PF12311  DUF3632  
Amino Acid Sequences MDRIQLRIETPAPHDFEAPIQTIINAAIQSTNPSPAKDAALALDAVYLDYIKNPNKDPGGVLTLFWELVNSFASQIPYESPAQEKLVTIVQELADITSKQTILNQKLWRNLPYFSSEFPQTWESVSPDADDNEKKRRFVNLQAYAARTLGLGLSSLEMYAIWAISDVAEGVMIPVRGSPDLVSADPKDVDQLPFKAAAAGVWILYAGHALYGRDEAIGGTQGGPLWMLPKAERRKLRRKFRGTQGLCRDRWLLWKQQFAAIRDCGSVDTETRTIAENVVDTMDRVDGHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.29
4 0.29
5 0.27
6 0.22
7 0.18
8 0.17
9 0.16
10 0.16
11 0.15
12 0.11
13 0.09
14 0.09
15 0.09
16 0.13
17 0.14
18 0.21
19 0.2
20 0.21
21 0.23
22 0.24
23 0.26
24 0.23
25 0.23
26 0.17
27 0.17
28 0.16
29 0.13
30 0.12
31 0.09
32 0.08
33 0.08
34 0.06
35 0.05
36 0.07
37 0.13
38 0.16
39 0.2
40 0.22
41 0.28
42 0.29
43 0.3
44 0.29
45 0.28
46 0.29
47 0.26
48 0.23
49 0.2
50 0.19
51 0.18
52 0.16
53 0.12
54 0.07
55 0.08
56 0.09
57 0.07
58 0.08
59 0.09
60 0.1
61 0.1
62 0.11
63 0.11
64 0.13
65 0.14
66 0.13
67 0.14
68 0.15
69 0.17
70 0.17
71 0.16
72 0.14
73 0.16
74 0.16
75 0.14
76 0.13
77 0.11
78 0.11
79 0.11
80 0.1
81 0.08
82 0.08
83 0.08
84 0.08
85 0.09
86 0.08
87 0.12
88 0.19
89 0.21
90 0.29
91 0.34
92 0.37
93 0.43
94 0.45
95 0.45
96 0.4
97 0.37
98 0.31
99 0.31
100 0.28
101 0.23
102 0.23
103 0.21
104 0.2
105 0.21
106 0.2
107 0.15
108 0.15
109 0.15
110 0.13
111 0.13
112 0.13
113 0.11
114 0.11
115 0.11
116 0.13
117 0.14
118 0.16
119 0.25
120 0.26
121 0.26
122 0.27
123 0.31
124 0.31
125 0.37
126 0.44
127 0.41
128 0.44
129 0.45
130 0.45
131 0.4
132 0.37
133 0.29
134 0.19
135 0.12
136 0.07
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.02
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.07
167 0.09
168 0.09
169 0.11
170 0.11
171 0.13
172 0.13
173 0.12
174 0.12
175 0.12
176 0.14
177 0.14
178 0.15
179 0.15
180 0.15
181 0.15
182 0.14
183 0.12
184 0.1
185 0.09
186 0.08
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.03
194 0.04
195 0.04
196 0.05
197 0.05
198 0.06
199 0.07
200 0.06
201 0.07
202 0.06
203 0.06
204 0.07
205 0.07
206 0.06
207 0.07
208 0.07
209 0.07
210 0.07
211 0.06
212 0.06
213 0.07
214 0.08
215 0.1
216 0.19
217 0.28
218 0.36
219 0.45
220 0.53
221 0.62
222 0.72
223 0.81
224 0.83
225 0.85
226 0.86
227 0.88
228 0.9
229 0.85
230 0.85
231 0.85
232 0.83
233 0.74
234 0.68
235 0.59
236 0.49
237 0.52
238 0.46
239 0.45
240 0.43
241 0.49
242 0.48
243 0.52
244 0.56
245 0.5
246 0.51
247 0.44
248 0.39
249 0.32
250 0.31
251 0.26
252 0.22
253 0.21
254 0.16
255 0.18
256 0.17
257 0.18
258 0.18
259 0.2
260 0.18
261 0.17
262 0.17
263 0.13
264 0.13
265 0.14
266 0.14
267 0.11
268 0.12
269 0.12