Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7G5T0

Protein Details
Accession A0A2G7G5T0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
114-144AIKADRARKKKASKVKKSRRKYREFGNGPKEBasic
NLS Segment(s)
PositionSequence
114-136AIKADRARKKKASKVKKSRRKYR
Subcellular Location(s) mito 16, nucl 7, cyto_nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MLLRNLIPRNLLPYTQPIAPLRCFTTTFHLTDKPLPPRLKIHDADLTISYLKGTGPGGQKINKTNSAVQLIHKPTGLVVKSQATRSRSQNEKIARQLLADKVEQLEKGDQSRAAIKADRARKKKASKVKKSRRKYREFGNGPKEVQEQEDRDGEGHQEPVGDESSTTVPANQTQDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.32
4 0.3
5 0.32
6 0.33
7 0.34
8 0.31
9 0.3
10 0.3
11 0.28
12 0.32
13 0.31
14 0.32
15 0.33
16 0.33
17 0.33
18 0.38
19 0.44
20 0.42
21 0.47
22 0.47
23 0.46
24 0.49
25 0.54
26 0.55
27 0.49
28 0.47
29 0.44
30 0.43
31 0.42
32 0.36
33 0.3
34 0.22
35 0.21
36 0.16
37 0.1
38 0.09
39 0.08
40 0.08
41 0.11
42 0.14
43 0.18
44 0.21
45 0.24
46 0.28
47 0.32
48 0.36
49 0.35
50 0.34
51 0.33
52 0.33
53 0.35
54 0.33
55 0.29
56 0.32
57 0.31
58 0.29
59 0.26
60 0.22
61 0.18
62 0.22
63 0.2
64 0.13
65 0.13
66 0.16
67 0.18
68 0.2
69 0.25
70 0.23
71 0.26
72 0.3
73 0.35
74 0.35
75 0.36
76 0.4
77 0.4
78 0.42
79 0.41
80 0.4
81 0.33
82 0.29
83 0.29
84 0.25
85 0.23
86 0.18
87 0.16
88 0.14
89 0.15
90 0.14
91 0.13
92 0.13
93 0.12
94 0.13
95 0.14
96 0.13
97 0.13
98 0.16
99 0.16
100 0.16
101 0.16
102 0.18
103 0.25
104 0.34
105 0.42
106 0.44
107 0.5
108 0.57
109 0.63
110 0.69
111 0.73
112 0.75
113 0.77
114 0.83
115 0.88
116 0.89
117 0.92
118 0.94
119 0.93
120 0.92
121 0.86
122 0.85
123 0.85
124 0.83
125 0.82
126 0.8
127 0.74
128 0.65
129 0.62
130 0.54
131 0.44
132 0.4
133 0.36
134 0.3
135 0.29
136 0.3
137 0.27
138 0.26
139 0.25
140 0.24
141 0.19
142 0.17
143 0.14
144 0.13
145 0.12
146 0.14
147 0.14
148 0.12
149 0.1
150 0.12
151 0.13
152 0.15
153 0.15
154 0.14
155 0.14
156 0.19