Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FNV4

Protein Details
Accession A0A2G7FNV4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-99NGKLHDAYKRCKRNKCRANQRYYPETGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 3, pero 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MVKIILSALAILAAIAPLTTAEKIKCNNATAYCGATLINRGGYLTEIREILKNHDEDLSGLLLQHGLFWCKENGKLHDAYKRCKRNKCRANQRYYPETGDGCKGEWRGSILPDMNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.05
6 0.06
7 0.08
8 0.1
9 0.14
10 0.17
11 0.22
12 0.25
13 0.26
14 0.3
15 0.29
16 0.32
17 0.29
18 0.29
19 0.23
20 0.2
21 0.18
22 0.14
23 0.14
24 0.1
25 0.1
26 0.08
27 0.07
28 0.07
29 0.08
30 0.09
31 0.08
32 0.08
33 0.08
34 0.09
35 0.12
36 0.12
37 0.15
38 0.18
39 0.18
40 0.17
41 0.18
42 0.17
43 0.15
44 0.15
45 0.12
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.06
52 0.05
53 0.06
54 0.06
55 0.07
56 0.09
57 0.1
58 0.14
59 0.18
60 0.21
61 0.24
62 0.27
63 0.29
64 0.35
65 0.38
66 0.42
67 0.48
68 0.55
69 0.59
70 0.66
71 0.73
72 0.77
73 0.82
74 0.85
75 0.87
76 0.87
77 0.88
78 0.87
79 0.85
80 0.8
81 0.75
82 0.67
83 0.59
84 0.51
85 0.44
86 0.4
87 0.33
88 0.28
89 0.28
90 0.25
91 0.23
92 0.23
93 0.25
94 0.23
95 0.24
96 0.29