Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7FJ14

Protein Details
Accession A0A2G7FJ14   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-63SKMFRFCRSKCHKNFKMKRQPRKLKWTKTSRAANGKEHydrophilic
157-180GKQNKIHSEERPRQKKRTRVLVDGBasic
NLS Segment(s)
PositionSequence
42-52KMKRQPRKLKW
104-131RQRRERAFTKRRLAGKVARDRKREADRR
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences LHRVETCHFCSRPVYPSKGISFVRLDSKMFRFCRSKCHKNFKMKRQPRKLKWTKTSRAANGKEMIVDSSLVLSQFAKKRNAPVKYDRNLVAATIKAMERVEEIRQRRERAFTKRRLAGKVARDRKREADRRVVAEGEHLIRKELRDREEGMPLVQEGKQNKIHSEERPRQKKRTRVLVDGTTQEEMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.47
4 0.48
5 0.52
6 0.49
7 0.45
8 0.4
9 0.37
10 0.39
11 0.35
12 0.33
13 0.31
14 0.36
15 0.4
16 0.39
17 0.42
18 0.43
19 0.42
20 0.52
21 0.56
22 0.62
23 0.64
24 0.73
25 0.76
26 0.8
27 0.89
28 0.89
29 0.91
30 0.9
31 0.91
32 0.92
33 0.94
34 0.92
35 0.93
36 0.92
37 0.91
38 0.91
39 0.9
40 0.87
41 0.86
42 0.84
43 0.81
44 0.8
45 0.73
46 0.67
47 0.59
48 0.51
49 0.42
50 0.34
51 0.27
52 0.17
53 0.14
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.1
61 0.14
62 0.18
63 0.22
64 0.23
65 0.31
66 0.38
67 0.43
68 0.43
69 0.49
70 0.54
71 0.53
72 0.56
73 0.49
74 0.43
75 0.38
76 0.33
77 0.25
78 0.15
79 0.12
80 0.1
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.09
87 0.12
88 0.17
89 0.2
90 0.27
91 0.32
92 0.35
93 0.35
94 0.41
95 0.44
96 0.48
97 0.56
98 0.56
99 0.6
100 0.63
101 0.66
102 0.63
103 0.61
104 0.57
105 0.57
106 0.59
107 0.61
108 0.62
109 0.61
110 0.61
111 0.65
112 0.68
113 0.68
114 0.63
115 0.64
116 0.61
117 0.61
118 0.59
119 0.51
120 0.41
121 0.34
122 0.31
123 0.23
124 0.21
125 0.17
126 0.17
127 0.17
128 0.19
129 0.24
130 0.27
131 0.28
132 0.29
133 0.34
134 0.35
135 0.4
136 0.39
137 0.32
138 0.28
139 0.24
140 0.23
141 0.2
142 0.21
143 0.17
144 0.22
145 0.28
146 0.28
147 0.3
148 0.35
149 0.38
150 0.42
151 0.51
152 0.56
153 0.61
154 0.7
155 0.75
156 0.79
157 0.84
158 0.85
159 0.84
160 0.85
161 0.81
162 0.78
163 0.79
164 0.76
165 0.72
166 0.66
167 0.6
168 0.5
169 0.42