Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7G414

Protein Details
Accession A0A2G7G414    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-77ILLRRHINSRRDRQRWRREMTVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 10, mito 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0004812  F:aminoacyl-tRNA ligase activity  
Amino Acid Sequences MNTFYIFFLLLAVLTQGCQALPTRAANVAPTFSAPFGAALGLGIILGVPLAAWGVILLRRHINSRRDRQRWRREMTVALKAEMAKEQATVARIPRFGGGQEVTKPPSCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.07
7 0.09
8 0.12
9 0.13
10 0.14
11 0.15
12 0.16
13 0.17
14 0.17
15 0.16
16 0.13
17 0.13
18 0.12
19 0.11
20 0.11
21 0.09
22 0.08
23 0.07
24 0.07
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.01
35 0.01
36 0.01
37 0.01
38 0.01
39 0.01
40 0.02
41 0.02
42 0.04
43 0.05
44 0.06
45 0.08
46 0.09
47 0.13
48 0.19
49 0.27
50 0.34
51 0.45
52 0.55
53 0.62
54 0.71
55 0.79
56 0.84
57 0.85
58 0.82
59 0.78
60 0.7
61 0.7
62 0.65
63 0.63
64 0.53
65 0.44
66 0.39
67 0.33
68 0.31
69 0.24
70 0.2
71 0.12
72 0.11
73 0.11
74 0.12
75 0.13
76 0.14
77 0.17
78 0.2
79 0.2
80 0.21
81 0.22
82 0.21
83 0.19
84 0.23
85 0.21
86 0.21
87 0.24
88 0.28
89 0.31