Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7G158

Protein Details
Accession A0A2G7G158   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-100RNWYKTPKGWVKQNDKPRNCRTVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 2
Family & Domain DBs
Amino Acid Sequences MKSPIYLLTALLPLTLPLANATPTAEPDDLDVEGSVLEDRDNCKVDRGFNYYKYPCDSSDITGRANRGDNVNFQCRYRNWYKTPKGWVKQNDKPRNCRTVTRHNANIISGANIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.07
5 0.08
6 0.09
7 0.09
8 0.11
9 0.09
10 0.11
11 0.14
12 0.13
13 0.12
14 0.13
15 0.14
16 0.13
17 0.12
18 0.11
19 0.07
20 0.07
21 0.07
22 0.06
23 0.04
24 0.04
25 0.05
26 0.07
27 0.1
28 0.12
29 0.12
30 0.16
31 0.17
32 0.2
33 0.23
34 0.29
35 0.3
36 0.31
37 0.38
38 0.36
39 0.36
40 0.36
41 0.34
42 0.27
43 0.27
44 0.24
45 0.2
46 0.24
47 0.24
48 0.22
49 0.22
50 0.22
51 0.19
52 0.2
53 0.18
54 0.16
55 0.16
56 0.2
57 0.23
58 0.29
59 0.29
60 0.28
61 0.32
62 0.3
63 0.36
64 0.37
65 0.4
66 0.41
67 0.51
68 0.58
69 0.59
70 0.69
71 0.72
72 0.71
73 0.73
74 0.75
75 0.74
76 0.75
77 0.8
78 0.8
79 0.78
80 0.82
81 0.81
82 0.8
83 0.74
84 0.74
85 0.71
86 0.71
87 0.74
88 0.73
89 0.72
90 0.69
91 0.67
92 0.59
93 0.54
94 0.43