Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G7GB74

Protein Details
Accession A0A2G7GB74    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
227-246IPFSRPIKKIHRSRKPLLVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 6, cyto 5, cyto_nucl 3.833, cyto_pero 3.833, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000383  Xaa-Pro-like_dom  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF02129  Peptidase_S15  
Amino Acid Sequences MPRREDVKIPATQITDLMIAVSCLLPEKCHPPPPVIIMGHGFGAVKAGGLFPFAERFAEAGYAAVMFDYLFFGESDGLPRNLLSISRELQDFRDVIAWVRRQTDKWDTDRVIAWGASFGGMHVTTLMAEDHDLVAGIMQGPCVDGLAASRQVPVFKTLRLLPLSLFDWILSPFSSKAIYIPLVSDGKHGSSLAMMSGSEAMDGWKRLTTDLGADFVNKVTARTILTIPFSRPIKKIHRSRKPLLVVVTTWDNEAPLHKAKQAVRLAPLGEGFRVPGGHFDLYAGGVAFEDNIRRQLQFLQKVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.22
3 0.17
4 0.15
5 0.1
6 0.08
7 0.09
8 0.08
9 0.06
10 0.09
11 0.09
12 0.1
13 0.14
14 0.21
15 0.26
16 0.34
17 0.36
18 0.36
19 0.4
20 0.43
21 0.47
22 0.41
23 0.37
24 0.31
25 0.3
26 0.27
27 0.23
28 0.18
29 0.1
30 0.11
31 0.09
32 0.07
33 0.06
34 0.07
35 0.06
36 0.07
37 0.07
38 0.07
39 0.09
40 0.09
41 0.1
42 0.09
43 0.1
44 0.09
45 0.1
46 0.09
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.03
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.09
63 0.11
64 0.12
65 0.11
66 0.11
67 0.11
68 0.11
69 0.12
70 0.11
71 0.13
72 0.14
73 0.15
74 0.16
75 0.16
76 0.18
77 0.2
78 0.18
79 0.14
80 0.15
81 0.14
82 0.15
83 0.21
84 0.22
85 0.21
86 0.25
87 0.26
88 0.25
89 0.31
90 0.37
91 0.37
92 0.38
93 0.43
94 0.4
95 0.4
96 0.4
97 0.35
98 0.28
99 0.22
100 0.18
101 0.11
102 0.1
103 0.08
104 0.07
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.03
126 0.03
127 0.04
128 0.04
129 0.04
130 0.03
131 0.02
132 0.03
133 0.05
134 0.06
135 0.06
136 0.07
137 0.08
138 0.08
139 0.09
140 0.12
141 0.11
142 0.11
143 0.13
144 0.13
145 0.17
146 0.17
147 0.17
148 0.14
149 0.15
150 0.16
151 0.14
152 0.13
153 0.09
154 0.09
155 0.08
156 0.09
157 0.07
158 0.07
159 0.06
160 0.07
161 0.08
162 0.07
163 0.07
164 0.09
165 0.09
166 0.08
167 0.09
168 0.11
169 0.12
170 0.12
171 0.13
172 0.11
173 0.11
174 0.12
175 0.11
176 0.08
177 0.07
178 0.07
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.07
189 0.07
190 0.08
191 0.09
192 0.09
193 0.1
194 0.11
195 0.1
196 0.12
197 0.12
198 0.13
199 0.11
200 0.12
201 0.12
202 0.11
203 0.13
204 0.1
205 0.1
206 0.09
207 0.11
208 0.11
209 0.13
210 0.14
211 0.14
212 0.18
213 0.19
214 0.2
215 0.25
216 0.27
217 0.28
218 0.3
219 0.35
220 0.41
221 0.49
222 0.58
223 0.63
224 0.7
225 0.75
226 0.8
227 0.82
228 0.78
229 0.73
230 0.66
231 0.58
232 0.48
233 0.43
234 0.41
235 0.31
236 0.26
237 0.21
238 0.18
239 0.15
240 0.16
241 0.17
242 0.18
243 0.2
244 0.21
245 0.28
246 0.3
247 0.39
248 0.43
249 0.42
250 0.4
251 0.42
252 0.4
253 0.35
254 0.35
255 0.27
256 0.22
257 0.18
258 0.15
259 0.14
260 0.14
261 0.12
262 0.13
263 0.16
264 0.16
265 0.15
266 0.15
267 0.15
268 0.14
269 0.15
270 0.12
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.1
277 0.11
278 0.15
279 0.17
280 0.17
281 0.19
282 0.27
283 0.35
284 0.4