Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A809

Protein Details
Accession A0A2H1A809   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
168-199EEPKKEEPKKEEPKKEEPKKEQPKKEESKKEEAcidic
NLS Segment(s)
PositionSequence
146-198GAKKEEPKKEEKKEEPATQEVKEEPKKEEPKKEEPKKEEPKKEQPKKEESKKE
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003016  2-oxoA_DH_lipoyl-BS  
IPR001078  2-oxoacid_DH_actylTfrase  
IPR000089  Biotin_lipoyl  
IPR023213  CAT-like_dom_sf  
IPR011053  Single_hybrid_motif  
IPR006255  SucB  
Gene Ontology GO:0045252  C:oxoglutarate dehydrogenase complex  
GO:0004149  F:dihydrolipoyllysine-residue succinyltransferase activity  
GO:0033512  P:L-lysine catabolic process to acetyl-CoA via saccharopine  
GO:0006099  P:tricarboxylic acid cycle  
Pfam View protein in Pfam  
PF00198  2-oxoacid_dh  
PF00364  Biotin_lipoyl  
PROSITE View protein in PROSITE  
PS50968  BIOTINYL_LIPOYL  
PS00189  LIPOYL  
CDD cd06849  lipoyl_domain  
Amino Acid Sequences MLSRSLRSSLRRIPAATRVSRKASLAGGLKMASVKSLHTRVATFGSNFGNLKSPVVSFQRLASTTVKVPEMAESITEGTLSAFNKEVGDYVEQDELVATIETDKIDVEVNAPVAGTVTELLASVEDTVEVGQEILKIEEGAAPEGGAKKEEPKKEEKKEEPATQEVKEEPKKEEPKKEEPKKEEPKKEQPKKEESKKEEPATFGGFSRSEERVKMNRMRLRIAERLKESQNTAASLTTFNEVDMSNLMEMRKLYKDEVLDKTGIKFGFMGAFSKAAALASKEIPAVNASIENNDTMVFRDYMDISVAVATPKGLVTPVVRNAESLSILGVEEEISKLSKKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINLPQTAVLGLHGIKQRPVTVNGQIVSRPMMYLALTYDHRVLDGREAVTFLKLIKEYIEDPRKMLLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.62
4 0.62
5 0.6
6 0.61
7 0.61
8 0.57
9 0.51
10 0.44
11 0.42
12 0.39
13 0.34
14 0.3
15 0.27
16 0.27
17 0.25
18 0.23
19 0.18
20 0.14
21 0.15
22 0.2
23 0.23
24 0.25
25 0.26
26 0.27
27 0.28
28 0.31
29 0.32
30 0.26
31 0.26
32 0.25
33 0.27
34 0.26
35 0.24
36 0.26
37 0.23
38 0.23
39 0.21
40 0.19
41 0.22
42 0.26
43 0.28
44 0.23
45 0.25
46 0.3
47 0.29
48 0.32
49 0.29
50 0.27
51 0.27
52 0.3
53 0.28
54 0.23
55 0.22
56 0.21
57 0.2
58 0.17
59 0.14
60 0.12
61 0.13
62 0.12
63 0.11
64 0.09
65 0.08
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.12
73 0.12
74 0.11
75 0.13
76 0.13
77 0.14
78 0.15
79 0.14
80 0.14
81 0.13
82 0.11
83 0.1
84 0.08
85 0.06
86 0.05
87 0.06
88 0.06
89 0.07
90 0.06
91 0.06
92 0.07
93 0.07
94 0.08
95 0.08
96 0.09
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.05
108 0.04
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.08
131 0.11
132 0.11
133 0.1
134 0.1
135 0.17
136 0.24
137 0.29
138 0.32
139 0.4
140 0.49
141 0.57
142 0.67
143 0.64
144 0.67
145 0.7
146 0.71
147 0.66
148 0.62
149 0.56
150 0.48
151 0.44
152 0.36
153 0.37
154 0.36
155 0.33
156 0.31
157 0.37
158 0.46
159 0.5
160 0.57
161 0.57
162 0.63
163 0.72
164 0.78
165 0.78
166 0.75
167 0.8
168 0.82
169 0.84
170 0.83
171 0.81
172 0.82
173 0.85
174 0.87
175 0.84
176 0.81
177 0.82
178 0.82
179 0.83
180 0.82
181 0.79
182 0.78
183 0.78
184 0.75
185 0.66
186 0.58
187 0.5
188 0.42
189 0.35
190 0.26
191 0.2
192 0.16
193 0.15
194 0.18
195 0.17
196 0.15
197 0.16
198 0.2
199 0.22
200 0.28
201 0.33
202 0.37
203 0.38
204 0.39
205 0.41
206 0.4
207 0.41
208 0.42
209 0.41
210 0.38
211 0.37
212 0.39
213 0.39
214 0.37
215 0.33
216 0.29
217 0.26
218 0.22
219 0.19
220 0.15
221 0.14
222 0.13
223 0.12
224 0.1
225 0.09
226 0.08
227 0.08
228 0.08
229 0.07
230 0.07
231 0.07
232 0.06
233 0.07
234 0.07
235 0.07
236 0.07
237 0.09
238 0.11
239 0.11
240 0.12
241 0.14
242 0.16
243 0.21
244 0.24
245 0.24
246 0.24
247 0.23
248 0.23
249 0.24
250 0.22
251 0.16
252 0.13
253 0.11
254 0.12
255 0.12
256 0.12
257 0.09
258 0.09
259 0.09
260 0.09
261 0.09
262 0.06
263 0.06
264 0.06
265 0.08
266 0.08
267 0.09
268 0.09
269 0.09
270 0.09
271 0.1
272 0.09
273 0.07
274 0.09
275 0.08
276 0.09
277 0.1
278 0.09
279 0.09
280 0.09
281 0.09
282 0.08
283 0.1
284 0.09
285 0.09
286 0.1
287 0.11
288 0.11
289 0.11
290 0.1
291 0.08
292 0.08
293 0.08
294 0.07
295 0.06
296 0.06
297 0.05
298 0.05
299 0.05
300 0.05
301 0.06
302 0.09
303 0.13
304 0.19
305 0.23
306 0.23
307 0.23
308 0.24
309 0.24
310 0.21
311 0.17
312 0.11
313 0.08
314 0.08
315 0.07
316 0.06
317 0.05
318 0.05
319 0.05
320 0.06
321 0.06
322 0.07
323 0.09
324 0.14
325 0.18
326 0.24
327 0.34
328 0.42
329 0.5
330 0.51
331 0.56
332 0.59
333 0.57
334 0.51
335 0.41
336 0.33
337 0.24
338 0.22
339 0.15
340 0.08
341 0.06
342 0.05
343 0.05
344 0.06
345 0.05
346 0.05
347 0.05
348 0.06
349 0.05
350 0.05
351 0.05
352 0.06
353 0.06
354 0.07
355 0.08
356 0.07
357 0.08
358 0.09
359 0.1
360 0.09
361 0.09
362 0.1
363 0.1
364 0.1
365 0.1
366 0.09
367 0.08
368 0.09
369 0.09
370 0.14
371 0.17
372 0.19
373 0.21
374 0.22
375 0.27
376 0.29
377 0.33
378 0.32
379 0.34
380 0.38
381 0.37
382 0.37
383 0.33
384 0.31
385 0.29
386 0.25
387 0.19
388 0.13
389 0.13
390 0.11
391 0.11
392 0.12
393 0.13
394 0.14
395 0.16
396 0.18
397 0.17
398 0.18
399 0.18
400 0.18
401 0.2
402 0.24
403 0.22
404 0.2
405 0.22
406 0.22
407 0.22
408 0.21
409 0.16
410 0.16
411 0.16
412 0.16
413 0.16
414 0.19
415 0.21
416 0.31
417 0.39
418 0.35
419 0.37
420 0.41