Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MJM4

Protein Details
Accession B8MJM4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNRKTSQTKFKVRCNRFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDASSARIKRNRKTSQTKFKVRCNRFLYTLVLKDSDKADKLKQSLPPALKIVDVSKGSKKKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.43
4 0.39
5 0.45
6 0.48
7 0.47
8 0.52
9 0.57
10 0.6
11 0.67
12 0.72
13 0.73
14 0.77
15 0.76
16 0.75
17 0.77
18 0.77
19 0.79
20 0.83
21 0.86
22 0.81
23 0.82
24 0.83
25 0.75
26 0.75
27 0.68
28 0.61
29 0.54
30 0.51
31 0.46
32 0.39
33 0.38
34 0.3
35 0.26
36 0.23
37 0.22
38 0.21
39 0.2
40 0.18
41 0.19
42 0.21
43 0.25
44 0.28
45 0.32
46 0.35
47 0.38
48 0.44
49 0.44
50 0.44
51 0.41
52 0.38
53 0.34
54 0.3
55 0.26
56 0.25
57 0.25
58 0.25
59 0.32
60 0.38