Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A112

Protein Details
Accession A0A2H1A112    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
204-224VDSVRHQKSRRTPPLPKTAMPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.333, mito 6.5, cyto_mito 6.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006931  Calcipressin  
Gene Ontology GO:0019722  P:calcium-mediated signaling  
Pfam View protein in Pfam  
PF04847  Calcipressin  
Amino Acid Sequences MPRQPTNTLIVSRLSGEAKENPAVLAGFLAEQGIQVELVSLPKLERYIIICGTSSLAIYVRDYLKSKLEPSVSIDFSLKDNHSAILGEENWALKAADTQYLELPSESGSRRFLISPPLSPQGEWNDYDKVEEGPNQTAVYSPEELSHLLWDRFGGFDSTHVKKYKEESEDEEEEIENDGEVYDISQQPQVLFENIDNGVPAIVVDSVRHQKSRRTPPLPKTAMPPMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.2
4 0.23
5 0.25
6 0.26
7 0.24
8 0.21
9 0.21
10 0.21
11 0.17
12 0.12
13 0.08
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.04
23 0.05
24 0.05
25 0.06
26 0.07
27 0.07
28 0.06
29 0.08
30 0.09
31 0.08
32 0.1
33 0.12
34 0.16
35 0.17
36 0.18
37 0.17
38 0.17
39 0.18
40 0.16
41 0.13
42 0.09
43 0.09
44 0.08
45 0.09
46 0.11
47 0.12
48 0.14
49 0.16
50 0.17
51 0.21
52 0.22
53 0.23
54 0.24
55 0.25
56 0.23
57 0.26
58 0.3
59 0.26
60 0.26
61 0.25
62 0.21
63 0.2
64 0.23
65 0.18
66 0.14
67 0.14
68 0.13
69 0.13
70 0.12
71 0.11
72 0.11
73 0.1
74 0.09
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.06
81 0.08
82 0.07
83 0.1
84 0.11
85 0.11
86 0.12
87 0.13
88 0.13
89 0.11
90 0.1
91 0.07
92 0.1
93 0.1
94 0.1
95 0.11
96 0.11
97 0.12
98 0.13
99 0.13
100 0.17
101 0.18
102 0.18
103 0.2
104 0.24
105 0.23
106 0.23
107 0.24
108 0.22
109 0.22
110 0.22
111 0.21
112 0.18
113 0.18
114 0.19
115 0.17
116 0.13
117 0.12
118 0.13
119 0.13
120 0.13
121 0.14
122 0.13
123 0.12
124 0.12
125 0.13
126 0.13
127 0.13
128 0.11
129 0.11
130 0.12
131 0.13
132 0.12
133 0.13
134 0.13
135 0.12
136 0.12
137 0.11
138 0.11
139 0.1
140 0.11
141 0.09
142 0.07
143 0.1
144 0.16
145 0.19
146 0.24
147 0.26
148 0.27
149 0.28
150 0.33
151 0.37
152 0.36
153 0.37
154 0.38
155 0.42
156 0.44
157 0.42
158 0.37
159 0.3
160 0.26
161 0.24
162 0.17
163 0.1
164 0.07
165 0.06
166 0.05
167 0.05
168 0.05
169 0.07
170 0.08
171 0.1
172 0.11
173 0.12
174 0.12
175 0.14
176 0.15
177 0.13
178 0.14
179 0.13
180 0.15
181 0.15
182 0.15
183 0.13
184 0.11
185 0.1
186 0.09
187 0.08
188 0.05
189 0.06
190 0.06
191 0.06
192 0.12
193 0.21
194 0.24
195 0.29
196 0.3
197 0.38
198 0.49
199 0.6
200 0.64
201 0.66
202 0.73
203 0.78
204 0.87
205 0.84
206 0.76
207 0.72