Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8M6C6

Protein Details
Accession B8M6C6    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-59GHSRWSTIKHDKAKNDKAKSKERGBasic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017856  Integrase-like_N  
IPR002876  Transcrip_reg_TACO1-like  
IPR026564  Transcrip_reg_TACO1-like_dom3  
IPR029072  YebC-like  
Pfam View protein in Pfam  
PF01709  Transcrip_reg  
Amino Acid Sequences MASAFGLRLTRRPRLNTQWVCDTCRSFHVSVAVQSGHSRWSTIKHDKAKNDKAKSKERGMLTQELINASQLWGPDPKNNPRLQLAIAKAKQSQMPKSIIDNAIARGQGVTASGQALEAVTIEAMLPGTVAAVIECMAENKARILQDVRFTIKDNGGSVTPTTYLFEKKGRIVFENKEGTNPDDYLDQAIEAGATDIDTDAEGRLVVYTEPTATKSVGEALSQATGLVIAQSQIIWDPNKDTMVKVEDPEQLNQLDEVLAALREESSVQDIFLNTTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.71
3 0.71
4 0.71
5 0.74
6 0.7
7 0.69
8 0.65
9 0.58
10 0.49
11 0.46
12 0.45
13 0.35
14 0.34
15 0.34
16 0.31
17 0.3
18 0.32
19 0.28
20 0.23
21 0.23
22 0.22
23 0.19
24 0.17
25 0.16
26 0.14
27 0.19
28 0.28
29 0.36
30 0.44
31 0.51
32 0.58
33 0.66
34 0.75
35 0.8
36 0.81
37 0.81
38 0.79
39 0.77
40 0.8
41 0.78
42 0.75
43 0.71
44 0.65
45 0.63
46 0.6
47 0.58
48 0.5
49 0.45
50 0.39
51 0.33
52 0.3
53 0.23
54 0.18
55 0.13
56 0.12
57 0.1
58 0.1
59 0.12
60 0.14
61 0.19
62 0.25
63 0.33
64 0.39
65 0.41
66 0.42
67 0.41
68 0.42
69 0.38
70 0.38
71 0.34
72 0.36
73 0.36
74 0.35
75 0.34
76 0.34
77 0.35
78 0.34
79 0.33
80 0.29
81 0.31
82 0.3
83 0.31
84 0.34
85 0.31
86 0.29
87 0.26
88 0.22
89 0.21
90 0.2
91 0.17
92 0.11
93 0.1
94 0.08
95 0.08
96 0.06
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.05
126 0.05
127 0.07
128 0.07
129 0.08
130 0.1
131 0.11
132 0.15
133 0.18
134 0.2
135 0.18
136 0.21
137 0.22
138 0.21
139 0.2
140 0.17
141 0.15
142 0.13
143 0.13
144 0.11
145 0.1
146 0.09
147 0.08
148 0.09
149 0.09
150 0.1
151 0.12
152 0.14
153 0.16
154 0.19
155 0.22
156 0.23
157 0.25
158 0.28
159 0.29
160 0.34
161 0.38
162 0.34
163 0.33
164 0.33
165 0.31
166 0.29
167 0.26
168 0.19
169 0.14
170 0.14
171 0.13
172 0.11
173 0.09
174 0.07
175 0.06
176 0.05
177 0.05
178 0.05
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.06
195 0.07
196 0.08
197 0.1
198 0.11
199 0.11
200 0.11
201 0.1
202 0.14
203 0.13
204 0.13
205 0.12
206 0.11
207 0.12
208 0.11
209 0.1
210 0.07
211 0.06
212 0.06
213 0.05
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.06
220 0.09
221 0.1
222 0.11
223 0.14
224 0.16
225 0.19
226 0.2
227 0.19
228 0.21
229 0.25
230 0.26
231 0.25
232 0.28
233 0.31
234 0.33
235 0.34
236 0.32
237 0.27
238 0.26
239 0.24
240 0.2
241 0.14
242 0.11
243 0.09
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.08
252 0.11
253 0.11
254 0.11
255 0.13
256 0.13