Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZC65

Protein Details
Accession A0A2H0ZC65    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-53LPPFERRKLLQKTQRANRAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016098  CAP/MinC_C  
IPR027684  TBCC  
IPR012945  Tubulin-bd_cofactor_C_dom  
Gene Ontology GO:0007023  P:post-chaperonin tubulin folding pathway  
Pfam View protein in Pfam  
PF07986  TBCC  
Amino Acid Sequences MDLISQINNCTSNDELCELKDKVGQLNKESKMPLPPFERRKLLQKTQRANRAIEEANNRVNSDYFRFEGPPQPPSLVPTHTESGNQPSSTVASNHFSDINNTTLDLDKWLAPGHASVSNVAFSTIFNNKVWPGSMRLENVADSTLTVNTTGPLMVRNVANSTLTVQCHQLRLHNLRNCTVYVRRNCAVVMEECAGIRFGERVQGEGKEGEGQVEKGEREGKANKVEPGPGAKNKASFRACLQVFDFSWPSSADNPNYDFVEGQASEASGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.25
5 0.23
6 0.23
7 0.24
8 0.23
9 0.28
10 0.34
11 0.37
12 0.37
13 0.45
14 0.45
15 0.47
16 0.47
17 0.42
18 0.45
19 0.44
20 0.44
21 0.43
22 0.5
23 0.54
24 0.59
25 0.63
26 0.57
27 0.64
28 0.66
29 0.69
30 0.69
31 0.71
32 0.74
33 0.77
34 0.83
35 0.77
36 0.7
37 0.62
38 0.58
39 0.51
40 0.46
41 0.43
42 0.38
43 0.4
44 0.39
45 0.37
46 0.31
47 0.3
48 0.26
49 0.24
50 0.23
51 0.19
52 0.2
53 0.21
54 0.23
55 0.29
56 0.29
57 0.28
58 0.26
59 0.27
60 0.25
61 0.26
62 0.27
63 0.21
64 0.21
65 0.22
66 0.23
67 0.21
68 0.22
69 0.21
70 0.24
71 0.26
72 0.24
73 0.19
74 0.18
75 0.19
76 0.19
77 0.18
78 0.14
79 0.14
80 0.15
81 0.15
82 0.16
83 0.15
84 0.16
85 0.17
86 0.17
87 0.13
88 0.13
89 0.13
90 0.12
91 0.12
92 0.11
93 0.1
94 0.08
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.1
106 0.1
107 0.1
108 0.08
109 0.06
110 0.09
111 0.1
112 0.11
113 0.11
114 0.12
115 0.12
116 0.12
117 0.13
118 0.11
119 0.13
120 0.14
121 0.16
122 0.16
123 0.16
124 0.16
125 0.16
126 0.15
127 0.12
128 0.09
129 0.07
130 0.07
131 0.06
132 0.05
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.05
140 0.06
141 0.07
142 0.07
143 0.07
144 0.08
145 0.09
146 0.09
147 0.08
148 0.1
149 0.12
150 0.12
151 0.12
152 0.15
153 0.16
154 0.18
155 0.19
156 0.21
157 0.25
158 0.31
159 0.39
160 0.4
161 0.41
162 0.41
163 0.42
164 0.38
165 0.36
166 0.35
167 0.34
168 0.35
169 0.4
170 0.38
171 0.37
172 0.36
173 0.33
174 0.3
175 0.23
176 0.21
177 0.16
178 0.16
179 0.14
180 0.15
181 0.14
182 0.11
183 0.1
184 0.07
185 0.06
186 0.12
187 0.12
188 0.13
189 0.15
190 0.15
191 0.17
192 0.16
193 0.17
194 0.14
195 0.14
196 0.14
197 0.14
198 0.13
199 0.13
200 0.15
201 0.15
202 0.14
203 0.18
204 0.16
205 0.21
206 0.25
207 0.29
208 0.34
209 0.37
210 0.39
211 0.38
212 0.39
213 0.36
214 0.39
215 0.41
216 0.38
217 0.41
218 0.39
219 0.44
220 0.44
221 0.51
222 0.45
223 0.41
224 0.39
225 0.43
226 0.41
227 0.38
228 0.38
229 0.34
230 0.33
231 0.36
232 0.34
233 0.25
234 0.26
235 0.23
236 0.24
237 0.23
238 0.28
239 0.25
240 0.28
241 0.3
242 0.32
243 0.32
244 0.31
245 0.26
246 0.21
247 0.24
248 0.2
249 0.18
250 0.16