Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A6W0

Protein Details
Accession A0A2H1A6W0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
395-417EINNWKSWSEKHKRDTRKFIEIQHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 7, plas 5, extr 5, cyto 3, vacu 3, golg 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001547  Glyco_hydro_5  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0071704  P:organic substance metabolic process  
Pfam View protein in Pfam  
PF00150  Cellulase  
Amino Acid Sequences MPMLFLILSLYSIGIGSVVAGVSGGAPTHGFNFSSVYSNRTNATYYNYTNAISSNDFSYRGVALGGWLVLEPYITPSLFLSFNESSHNSSDIPKDEYRFCEKLGEEEASKRLQKHWSTFYNASDFADIKAYGFNMVRIPVGYWAFETLDDDPYVPGAQEYLDKAIEWAHDNDLKVWIDLHGAPNSQNGFDNSGLFRKNEPGWQDKSEYVDLTLKVLRQIYAKYGSAEFSERYNDTILGIEVLNEPMGPKLKMPKLKDFYDKAYTAARSIQETNNTIVFHDAFQKAGYWNNFRQHNNNMTNITRNYNILIDHHHYEVFGVGQLNSSIAQHIENIKNYASGIEDELNHHPAVVGEWSAALTDCAPWLNSVNWGTRWEGTPPYDNSPIKSKSIKNCHEINNWKSWSEKHKRDTRKFIEIQLDQYESKTNGWIFWCYKTETTIEWDFKRLAQYGLFPQPFEDRQYIKNGTDTKPDKSGSSRQFGLSTSSLFVAIFLSFFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.04
12 0.04
13 0.05
14 0.06
15 0.09
16 0.1
17 0.11
18 0.11
19 0.14
20 0.15
21 0.21
22 0.21
23 0.23
24 0.24
25 0.26
26 0.27
27 0.26
28 0.26
29 0.21
30 0.28
31 0.3
32 0.29
33 0.31
34 0.31
35 0.3
36 0.28
37 0.28
38 0.24
39 0.2
40 0.19
41 0.18
42 0.19
43 0.19
44 0.19
45 0.2
46 0.17
47 0.15
48 0.14
49 0.1
50 0.09
51 0.09
52 0.09
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.07
60 0.09
61 0.09
62 0.1
63 0.1
64 0.13
65 0.14
66 0.14
67 0.18
68 0.17
69 0.17
70 0.22
71 0.23
72 0.23
73 0.24
74 0.26
75 0.2
76 0.22
77 0.26
78 0.24
79 0.28
80 0.28
81 0.3
82 0.32
83 0.36
84 0.41
85 0.38
86 0.36
87 0.36
88 0.34
89 0.34
90 0.34
91 0.32
92 0.26
93 0.27
94 0.29
95 0.28
96 0.31
97 0.28
98 0.29
99 0.34
100 0.38
101 0.42
102 0.47
103 0.48
104 0.52
105 0.54
106 0.53
107 0.49
108 0.44
109 0.38
110 0.31
111 0.27
112 0.2
113 0.19
114 0.15
115 0.12
116 0.12
117 0.11
118 0.12
119 0.12
120 0.12
121 0.11
122 0.12
123 0.12
124 0.11
125 0.12
126 0.13
127 0.13
128 0.12
129 0.11
130 0.12
131 0.12
132 0.12
133 0.13
134 0.11
135 0.12
136 0.12
137 0.12
138 0.1
139 0.1
140 0.1
141 0.08
142 0.07
143 0.05
144 0.05
145 0.07
146 0.08
147 0.09
148 0.09
149 0.09
150 0.09
151 0.1
152 0.11
153 0.12
154 0.12
155 0.14
156 0.16
157 0.17
158 0.17
159 0.2
160 0.19
161 0.16
162 0.15
163 0.12
164 0.12
165 0.13
166 0.15
167 0.12
168 0.12
169 0.13
170 0.16
171 0.16
172 0.15
173 0.15
174 0.13
175 0.15
176 0.14
177 0.16
178 0.14
179 0.16
180 0.17
181 0.16
182 0.16
183 0.17
184 0.18
185 0.2
186 0.23
187 0.25
188 0.28
189 0.3
190 0.32
191 0.29
192 0.31
193 0.29
194 0.25
195 0.21
196 0.2
197 0.18
198 0.17
199 0.17
200 0.14
201 0.14
202 0.15
203 0.14
204 0.12
205 0.13
206 0.14
207 0.16
208 0.17
209 0.16
210 0.16
211 0.16
212 0.15
213 0.16
214 0.14
215 0.11
216 0.13
217 0.12
218 0.12
219 0.12
220 0.11
221 0.1
222 0.1
223 0.09
224 0.07
225 0.07
226 0.06
227 0.06
228 0.06
229 0.05
230 0.05
231 0.05
232 0.05
233 0.07
234 0.06
235 0.07
236 0.13
237 0.18
238 0.25
239 0.28
240 0.37
241 0.41
242 0.44
243 0.5
244 0.46
245 0.46
246 0.45
247 0.42
248 0.34
249 0.32
250 0.29
251 0.23
252 0.23
253 0.19
254 0.16
255 0.18
256 0.19
257 0.19
258 0.2
259 0.21
260 0.2
261 0.19
262 0.17
263 0.15
264 0.14
265 0.11
266 0.14
267 0.13
268 0.11
269 0.11
270 0.12
271 0.12
272 0.16
273 0.18
274 0.18
275 0.22
276 0.28
277 0.34
278 0.35
279 0.39
280 0.41
281 0.47
282 0.45
283 0.44
284 0.4
285 0.36
286 0.39
287 0.36
288 0.32
289 0.24
290 0.22
291 0.19
292 0.18
293 0.17
294 0.13
295 0.16
296 0.17
297 0.18
298 0.18
299 0.17
300 0.16
301 0.15
302 0.15
303 0.1
304 0.08
305 0.07
306 0.06
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.06
313 0.06
314 0.06
315 0.07
316 0.13
317 0.16
318 0.17
319 0.18
320 0.18
321 0.18
322 0.18
323 0.16
324 0.12
325 0.1
326 0.1
327 0.1
328 0.11
329 0.13
330 0.16
331 0.18
332 0.16
333 0.15
334 0.13
335 0.12
336 0.12
337 0.1
338 0.08
339 0.06
340 0.06
341 0.06
342 0.06
343 0.06
344 0.05
345 0.05
346 0.05
347 0.05
348 0.06
349 0.06
350 0.07
351 0.09
352 0.09
353 0.13
354 0.15
355 0.18
356 0.19
357 0.2
358 0.22
359 0.21
360 0.23
361 0.21
362 0.22
363 0.22
364 0.27
365 0.28
366 0.32
367 0.39
368 0.38
369 0.38
370 0.42
371 0.42
372 0.4
373 0.44
374 0.45
375 0.47
376 0.57
377 0.61
378 0.59
379 0.63
380 0.65
381 0.68
382 0.71
383 0.65
384 0.64
385 0.6
386 0.55
387 0.5
388 0.48
389 0.49
390 0.5
391 0.55
392 0.55
393 0.63
394 0.73
395 0.81
396 0.87
397 0.83
398 0.83
399 0.77
400 0.74
401 0.73
402 0.65
403 0.6
404 0.53
405 0.49
406 0.39
407 0.36
408 0.34
409 0.26
410 0.24
411 0.24
412 0.2
413 0.2
414 0.21
415 0.27
416 0.25
417 0.29
418 0.31
419 0.31
420 0.31
421 0.31
422 0.3
423 0.26
424 0.3
425 0.33
426 0.36
427 0.34
428 0.36
429 0.35
430 0.35
431 0.38
432 0.33
433 0.27
434 0.23
435 0.26
436 0.3
437 0.39
438 0.37
439 0.33
440 0.33
441 0.37
442 0.37
443 0.38
444 0.37
445 0.3
446 0.32
447 0.4
448 0.42
449 0.38
450 0.43
451 0.44
452 0.41
453 0.49
454 0.49
455 0.46
456 0.48
457 0.48
458 0.45
459 0.45
460 0.52
461 0.49
462 0.53
463 0.51
464 0.47
465 0.47
466 0.45
467 0.44
468 0.36
469 0.3
470 0.25
471 0.22
472 0.2
473 0.18
474 0.17
475 0.13
476 0.11