Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H0ZZ15

Protein Details
Accession A0A2H0ZZ15    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
17-44PEYISEKRKERELKKQQKREELIKRGIDBasic
NLS Segment(s)
PositionSequence
23-36KRKERELKKQQKRE
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF03372  Exo_endo_phos  
Amino Acid Sequences METKRKPGAKDPSTITPEYISEKRKERELKKQQKREELIKRGIDPDAKPLPSHMKVIQRPMLDIYRSKASGEGLEIKIMTYNMLAQALIRRNLFPTSGAALKWAHRSQRLGFEIQSYNADILCLQELDYDQYNSHWKKEFMKWGYSSQYHRSGMKRHGVAILYKNSLFKFQHSYFIDYDKFVTTGVPLATQTQNVGLLVYLKFHEEVKKAHRGLSKDGVIIGTTHLFWHPFGTFERTRQTYIVQHEMKEFTKMMHLLYGADEKFYRFFAGDFNAQPYDSPYLSMTAKPVQYKDRAKRVLGKAASHKWDDQDADDGGEDVSQDDETEPEVFECSQDISDKIERLQKLHNDLDMRFISLYSVAYRQVHPENAVPSDRYEPPFSNWAHAWRGLLDYIFVASEWNGEKMDDAVDSVDELESQQQVRLLSLLRMPTPEEMGPEPSGQPRNGQYPSDHLCLMARVELC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.53
3 0.44
4 0.41
5 0.4
6 0.41
7 0.37
8 0.38
9 0.46
10 0.48
11 0.55
12 0.63
13 0.65
14 0.7
15 0.75
16 0.8
17 0.82
18 0.89
19 0.89
20 0.89
21 0.89
22 0.88
23 0.87
24 0.85
25 0.83
26 0.78
27 0.72
28 0.64
29 0.61
30 0.56
31 0.47
32 0.46
33 0.44
34 0.39
35 0.37
36 0.38
37 0.42
38 0.39
39 0.42
40 0.39
41 0.42
42 0.45
43 0.53
44 0.55
45 0.47
46 0.46
47 0.46
48 0.46
49 0.39
50 0.37
51 0.33
52 0.34
53 0.33
54 0.32
55 0.29
56 0.25
57 0.23
58 0.24
59 0.27
60 0.22
61 0.23
62 0.22
63 0.21
64 0.21
65 0.19
66 0.16
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.08
73 0.15
74 0.19
75 0.22
76 0.22
77 0.22
78 0.24
79 0.25
80 0.25
81 0.19
82 0.17
83 0.18
84 0.18
85 0.18
86 0.18
87 0.19
88 0.21
89 0.27
90 0.28
91 0.3
92 0.32
93 0.37
94 0.38
95 0.45
96 0.46
97 0.41
98 0.38
99 0.38
100 0.36
101 0.33
102 0.31
103 0.22
104 0.19
105 0.16
106 0.15
107 0.1
108 0.09
109 0.09
110 0.07
111 0.06
112 0.07
113 0.07
114 0.1
115 0.12
116 0.12
117 0.11
118 0.13
119 0.22
120 0.22
121 0.25
122 0.26
123 0.27
124 0.32
125 0.39
126 0.48
127 0.43
128 0.48
129 0.47
130 0.48
131 0.52
132 0.5
133 0.47
134 0.43
135 0.46
136 0.41
137 0.43
138 0.42
139 0.42
140 0.45
141 0.48
142 0.44
143 0.38
144 0.39
145 0.36
146 0.36
147 0.35
148 0.33
149 0.27
150 0.27
151 0.27
152 0.24
153 0.28
154 0.25
155 0.22
156 0.26
157 0.25
158 0.33
159 0.33
160 0.36
161 0.32
162 0.35
163 0.34
164 0.26
165 0.26
166 0.18
167 0.17
168 0.12
169 0.12
170 0.08
171 0.09
172 0.09
173 0.08
174 0.07
175 0.1
176 0.11
177 0.11
178 0.11
179 0.09
180 0.09
181 0.08
182 0.08
183 0.05
184 0.07
185 0.06
186 0.07
187 0.07
188 0.07
189 0.08
190 0.09
191 0.12
192 0.13
193 0.16
194 0.21
195 0.29
196 0.29
197 0.34
198 0.36
199 0.35
200 0.38
201 0.4
202 0.36
203 0.28
204 0.28
205 0.23
206 0.2
207 0.17
208 0.13
209 0.07
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.08
216 0.07
217 0.08
218 0.09
219 0.15
220 0.16
221 0.17
222 0.23
223 0.23
224 0.24
225 0.23
226 0.24
227 0.23
228 0.26
229 0.32
230 0.28
231 0.27
232 0.28
233 0.3
234 0.28
235 0.25
236 0.21
237 0.13
238 0.14
239 0.14
240 0.12
241 0.11
242 0.11
243 0.09
244 0.1
245 0.14
246 0.11
247 0.11
248 0.11
249 0.11
250 0.11
251 0.11
252 0.11
253 0.07
254 0.07
255 0.08
256 0.11
257 0.14
258 0.13
259 0.16
260 0.16
261 0.15
262 0.15
263 0.15
264 0.15
265 0.13
266 0.13
267 0.11
268 0.13
269 0.14
270 0.14
271 0.14
272 0.15
273 0.18
274 0.19
275 0.21
276 0.23
277 0.3
278 0.39
279 0.45
280 0.51
281 0.52
282 0.53
283 0.6
284 0.6
285 0.61
286 0.54
287 0.51
288 0.49
289 0.51
290 0.53
291 0.46
292 0.42
293 0.35
294 0.35
295 0.32
296 0.25
297 0.22
298 0.18
299 0.16
300 0.15
301 0.14
302 0.1
303 0.09
304 0.08
305 0.05
306 0.05
307 0.04
308 0.05
309 0.05
310 0.05
311 0.06
312 0.07
313 0.07
314 0.06
315 0.08
316 0.08
317 0.08
318 0.08
319 0.08
320 0.08
321 0.09
322 0.09
323 0.13
324 0.16
325 0.17
326 0.19
327 0.24
328 0.24
329 0.26
330 0.32
331 0.33
332 0.37
333 0.39
334 0.4
335 0.37
336 0.36
337 0.4
338 0.33
339 0.3
340 0.23
341 0.2
342 0.17
343 0.14
344 0.15
345 0.1
346 0.11
347 0.13
348 0.15
349 0.15
350 0.2
351 0.23
352 0.24
353 0.24
354 0.27
355 0.27
356 0.28
357 0.29
358 0.26
359 0.24
360 0.27
361 0.29
362 0.29
363 0.3
364 0.29
365 0.31
366 0.37
367 0.35
368 0.35
369 0.33
370 0.34
371 0.34
372 0.33
373 0.3
374 0.24
375 0.25
376 0.21
377 0.19
378 0.15
379 0.12
380 0.11
381 0.1
382 0.08
383 0.07
384 0.06
385 0.09
386 0.1
387 0.11
388 0.11
389 0.11
390 0.12
391 0.12
392 0.13
393 0.1
394 0.09
395 0.08
396 0.08
397 0.08
398 0.08
399 0.07
400 0.07
401 0.07
402 0.09
403 0.1
404 0.11
405 0.12
406 0.14
407 0.14
408 0.15
409 0.16
410 0.15
411 0.15
412 0.18
413 0.21
414 0.2
415 0.21
416 0.22
417 0.22
418 0.25
419 0.23
420 0.23
421 0.22
422 0.25
423 0.26
424 0.26
425 0.26
426 0.29
427 0.33
428 0.31
429 0.33
430 0.34
431 0.4
432 0.42
433 0.42
434 0.37
435 0.41
436 0.46
437 0.44
438 0.4
439 0.33
440 0.3
441 0.3
442 0.29