Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A975

Protein Details
Accession A0A2H1A975   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-74KDMPSRRTVREKREPPQVKKRVAKVKKPSKAPTRKNPTRKSRTQGEKVBasic
NLS Segment(s)
PositionSequence
32-86RRTVREKREPPQVKKRVAKVKKPSKAPTRKNPTRKSRTQGEKVPKKEPEESPRLK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MVLSEDSFERDLLRYNELLKRSEELEKDMPSRRTVREKREPPQVKKRVAKVKKPSKAPTRKNPTRKSRTQGEKVPKKEPEESPRLKLPKQAYMTTPSVAAPLKKEVNRSWLRSKAKSFEDIVVVNSTYSDLIRSVTNAGDGTIDFGMRHGFVPKNLEYEKKRFEFDSASVFDSILSRRPSFSDDIDRFFRQLSANSFEQAPNEVPLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.31
4 0.32
5 0.34
6 0.3
7 0.3
8 0.29
9 0.34
10 0.31
11 0.32
12 0.34
13 0.36
14 0.39
15 0.44
16 0.43
17 0.41
18 0.45
19 0.44
20 0.5
21 0.54
22 0.6
23 0.63
24 0.7
25 0.71
26 0.78
27 0.82
28 0.8
29 0.83
30 0.82
31 0.81
32 0.8
33 0.82
34 0.82
35 0.81
36 0.82
37 0.82
38 0.84
39 0.82
40 0.83
41 0.83
42 0.83
43 0.85
44 0.84
45 0.84
46 0.84
47 0.87
48 0.88
49 0.89
50 0.89
51 0.88
52 0.86
53 0.82
54 0.81
55 0.8
56 0.77
57 0.76
58 0.76
59 0.76
60 0.72
61 0.73
62 0.68
63 0.62
64 0.61
65 0.59
66 0.56
67 0.56
68 0.55
69 0.51
70 0.54
71 0.53
72 0.48
73 0.47
74 0.42
75 0.41
76 0.41
77 0.39
78 0.34
79 0.35
80 0.36
81 0.3
82 0.28
83 0.2
84 0.17
85 0.16
86 0.15
87 0.1
88 0.13
89 0.17
90 0.17
91 0.21
92 0.2
93 0.29
94 0.33
95 0.37
96 0.39
97 0.43
98 0.47
99 0.48
100 0.5
101 0.46
102 0.44
103 0.42
104 0.38
105 0.31
106 0.28
107 0.24
108 0.22
109 0.18
110 0.16
111 0.12
112 0.1
113 0.09
114 0.07
115 0.06
116 0.06
117 0.05
118 0.06
119 0.06
120 0.07
121 0.08
122 0.08
123 0.09
124 0.08
125 0.08
126 0.07
127 0.07
128 0.08
129 0.07
130 0.07
131 0.06
132 0.07
133 0.07
134 0.07
135 0.08
136 0.1
137 0.11
138 0.12
139 0.18
140 0.19
141 0.24
142 0.25
143 0.32
144 0.33
145 0.4
146 0.46
147 0.43
148 0.44
149 0.4
150 0.41
151 0.38
152 0.34
153 0.34
154 0.28
155 0.28
156 0.26
157 0.25
158 0.23
159 0.2
160 0.19
161 0.19
162 0.21
163 0.19
164 0.2
165 0.22
166 0.25
167 0.27
168 0.31
169 0.35
170 0.34
171 0.39
172 0.43
173 0.43
174 0.4
175 0.38
176 0.35
177 0.27
178 0.29
179 0.28
180 0.29
181 0.29
182 0.3
183 0.31
184 0.29
185 0.28
186 0.27
187 0.23