Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H0ZP34

Protein Details
Accession A0A2H0ZP34    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSLRSKSKLRAKSVKRKGEFHydrophilic
75-95GLKNTSRIRKRGLKKRGHTKFBasic
NLS Segment(s)
PositionSequence
6-20RSKSKLRAKSVKRKG
77-95KNTSRIRKRGLKKRGHTKF
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKLRAKSVKRKGEFAAFVNERTARLAERARALAEKQKAEKSEDAMEEEDKPEEKAPAESLKNVKTSGLKNTSRIRKRGLKKRGHTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.87
4 0.8
5 0.76
6 0.7
7 0.67
8 0.6
9 0.51
10 0.5
11 0.41
12 0.38
13 0.37
14 0.33
15 0.26
16 0.24
17 0.22
18 0.13
19 0.16
20 0.18
21 0.17
22 0.19
23 0.2
24 0.19
25 0.2
26 0.2
27 0.23
28 0.24
29 0.25
30 0.25
31 0.28
32 0.28
33 0.3
34 0.29
35 0.26
36 0.25
37 0.22
38 0.22
39 0.19
40 0.19
41 0.16
42 0.16
43 0.14
44 0.11
45 0.11
46 0.1
47 0.1
48 0.1
49 0.1
50 0.12
51 0.17
52 0.18
53 0.22
54 0.25
55 0.27
56 0.28
57 0.27
58 0.27
59 0.26
60 0.28
61 0.33
62 0.37
63 0.37
64 0.42
65 0.51
66 0.6
67 0.62
68 0.64
69 0.64
70 0.65
71 0.73
72 0.77
73 0.78
74 0.79
75 0.81