Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZUB3

Protein Details
Accession A0A2H0ZUB3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-24QRVTYRRKTPYNTKSNKIRVVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTYRRKTPYNTKSNKIRVVKTPGGKLVAQHLKKQATTPKCGDCGISLQGIATLRPRQYAQISKTKKTVQRAYGGSRCANCVKERIVRAFLIEEQKIVKRVLKDQQEKQAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.81
4 0.81
5 0.82
6 0.78
7 0.72
8 0.69
9 0.71
10 0.7
11 0.65
12 0.61
13 0.55
14 0.51
15 0.47
16 0.39
17 0.4
18 0.41
19 0.38
20 0.37
21 0.4
22 0.4
23 0.4
24 0.43
25 0.43
26 0.38
27 0.42
28 0.42
29 0.39
30 0.38
31 0.38
32 0.34
33 0.26
34 0.24
35 0.2
36 0.16
37 0.12
38 0.1
39 0.11
40 0.1
41 0.1
42 0.09
43 0.11
44 0.1
45 0.12
46 0.12
47 0.13
48 0.17
49 0.24
50 0.26
51 0.33
52 0.37
53 0.39
54 0.43
55 0.47
56 0.48
57 0.5
58 0.53
59 0.47
60 0.5
61 0.52
62 0.54
63 0.52
64 0.51
65 0.46
66 0.39
67 0.38
68 0.34
69 0.33
70 0.27
71 0.26
72 0.28
73 0.31
74 0.35
75 0.36
76 0.36
77 0.34
78 0.34
79 0.33
80 0.32
81 0.32
82 0.28
83 0.24
84 0.24
85 0.27
86 0.28
87 0.27
88 0.27
89 0.24
90 0.31
91 0.39
92 0.47
93 0.53
94 0.58
95 0.67