Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A2N0

Protein Details
Accession A0A2H1A2N0   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40GYLWKKAPRLSQPQKQRLRRRMQLVDHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRSSLVAYGGYLWKKAPRLSQPQKQRLRRRMQLVDHNIEVLYQSLKQDNSVSTGYKKIDALKFEFPKENEMSPRDKYTTFDKKVRGYRKSVHFVPKWTKKSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.2
5 0.24
6 0.27
7 0.32
8 0.35
9 0.46
10 0.55
11 0.62
12 0.69
13 0.76
14 0.82
15 0.85
16 0.87
17 0.86
18 0.86
19 0.85
20 0.83
21 0.81
22 0.78
23 0.78
24 0.74
25 0.69
26 0.59
27 0.51
28 0.42
29 0.33
30 0.27
31 0.17
32 0.1
33 0.06
34 0.07
35 0.09
36 0.09
37 0.1
38 0.11
39 0.1
40 0.13
41 0.13
42 0.14
43 0.13
44 0.16
45 0.15
46 0.15
47 0.16
48 0.18
49 0.19
50 0.21
51 0.24
52 0.29
53 0.31
54 0.32
55 0.36
56 0.31
57 0.33
58 0.33
59 0.32
60 0.28
61 0.28
62 0.3
63 0.29
64 0.32
65 0.3
66 0.28
67 0.28
68 0.33
69 0.41
70 0.42
71 0.45
72 0.47
73 0.53
74 0.62
75 0.68
76 0.64
77 0.61
78 0.64
79 0.67
80 0.7
81 0.68
82 0.69
83 0.64
84 0.67
85 0.7
86 0.72
87 0.7
88 0.69
89 0.72
90 0.69
91 0.76
92 0.78
93 0.79