Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A0L9

Protein Details
Accession A0A2H1A0L9   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-132RYEKMAEKMHRKKVERMRKKEKRNKALRERBasic
NLS Segment(s)
PositionSequence
39-40KK
59-132REKKKLEEEQYKARLRELKQEKEDEKNSKIAEIKRRRELKEEKERYEKMAEKMHRKKVERMRKKEKRNKALRER
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSATADKPLKEIPKQYINPLAEKAPTEGPRVNGKNFKIKKDAFRVRSLGVRKLNTWELREKKKLEEEQYKARLRELKQEKEDEKNSKIAEIKRRRELKEEKERYEKMAEKMHRKKVERMRKKEKRNKALRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.56
4 0.52
5 0.5
6 0.46
7 0.41
8 0.32
9 0.31
10 0.29
11 0.27
12 0.27
13 0.29
14 0.29
15 0.3
16 0.37
17 0.4
18 0.42
19 0.42
20 0.43
21 0.49
22 0.51
23 0.52
24 0.51
25 0.52
26 0.55
27 0.59
28 0.65
29 0.59
30 0.6
31 0.58
32 0.51
33 0.53
34 0.49
35 0.45
36 0.41
37 0.39
38 0.34
39 0.36
40 0.4
41 0.36
42 0.36
43 0.37
44 0.39
45 0.44
46 0.49
47 0.46
48 0.43
49 0.48
50 0.5
51 0.49
52 0.51
53 0.48
54 0.51
55 0.57
56 0.58
57 0.51
58 0.48
59 0.46
60 0.38
61 0.45
62 0.44
63 0.44
64 0.45
65 0.51
66 0.52
67 0.53
68 0.58
69 0.53
70 0.47
71 0.44
72 0.4
73 0.36
74 0.39
75 0.37
76 0.42
77 0.47
78 0.51
79 0.56
80 0.64
81 0.63
82 0.67
83 0.7
84 0.7
85 0.72
86 0.73
87 0.71
88 0.72
89 0.71
90 0.65
91 0.64
92 0.59
93 0.52
94 0.53
95 0.54
96 0.56
97 0.64
98 0.7
99 0.71
100 0.7
101 0.75
102 0.77
103 0.81
104 0.81
105 0.83
106 0.84
107 0.86
108 0.93
109 0.93
110 0.94
111 0.93
112 0.93