Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZKH9

Protein Details
Accession A0A2H0ZKH9   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MRPSLVRYIRPRRPERKTPPLLPPLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0005759  C:mitochondrial matrix  
GO:0015976  P:carbon utilization  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
GO:0006111  P:regulation of gluconeogenesis  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRPSLVRYIRPRRPERKTPPLLPPLKLYRSILRAHRTKLPAELRFLGDEYVKSEFKAHKTTDNPMHIIGFLTQWQDYLRSIDGGTWQQGKMTQQDLDKMSPEQVSQLYELMQETKRLGQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.86
5 0.83
6 0.82
7 0.82
8 0.78
9 0.69
10 0.66
11 0.62
12 0.56
13 0.53
14 0.46
15 0.41
16 0.41
17 0.44
18 0.44
19 0.44
20 0.46
21 0.46
22 0.5
23 0.47
24 0.45
25 0.48
26 0.49
27 0.43
28 0.42
29 0.41
30 0.35
31 0.33
32 0.32
33 0.25
34 0.17
35 0.15
36 0.12
37 0.14
38 0.12
39 0.12
40 0.14
41 0.16
42 0.18
43 0.23
44 0.23
45 0.25
46 0.27
47 0.32
48 0.36
49 0.37
50 0.34
51 0.3
52 0.29
53 0.23
54 0.21
55 0.16
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.1
65 0.1
66 0.09
67 0.1
68 0.1
69 0.13
70 0.13
71 0.15
72 0.15
73 0.15
74 0.14
75 0.17
76 0.18
77 0.18
78 0.2
79 0.2
80 0.19
81 0.25
82 0.27
83 0.27
84 0.27
85 0.25
86 0.24
87 0.22
88 0.21
89 0.18
90 0.17
91 0.17
92 0.16
93 0.15
94 0.14
95 0.13
96 0.14
97 0.16
98 0.16
99 0.16
100 0.17