Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MH98

Protein Details
Accession B8MH98    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-124LYLGSRTFDNRKRRARRAGNGARKEIHydrophilic
394-414SIAPPRKSILGRKTRRKAVVYHydrophilic
NLS Segment(s)
PositionSequence
109-121RKRRARRAGNGAR
404-409GRKTRR
Subcellular Location(s) cyto 13, cyto_nucl 9.833, cyto_mito 8.333, nucl 5.5, extr 3, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013952  DUF1776_fun  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08643  DUF1776  
Amino Acid Sequences MTSDDQFFLDFLSSIPHDVKRYSANVADSIDRHVDHAASVIKETLTVYFPNILPVGARNVPALRQPPPKSLTDKAYDWVMRNRAWTAAVVAFFGTSAVLYLGSRTFDNRKRRARRAGNGARKEIVVIAGSPHEPMTRAIAEDLERRGFIVYVVVQSAEEEHTIQMQNRSDIRALHLDLTITPSTPSEIHPALHGLYSLISQPQYPAPGIQPHTCQLSGLIILPSLNYPTGPIPTITASSWADTINTRVLAPILITQLFIPLLTHRNHSSSIVFLYPSISSSLSAPYAGPEVAATRALSGFATSLRQELRLLQFGNGTQCNVDVVEMKLGNVDLGPHYRVPQVAGTEVLAWSQHHRSLYGPSYLASVEQRPVASAGPNAIRGSPARALHNAIFDSIAPPRKSILGRKTRRKAVVYVGRGSRSYGIIGAWIPTNLVGWMLGQGNLPHSAPDSGNSSETSWERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.2
4 0.22
5 0.23
6 0.26
7 0.27
8 0.3
9 0.32
10 0.33
11 0.32
12 0.32
13 0.34
14 0.34
15 0.29
16 0.3
17 0.29
18 0.25
19 0.23
20 0.22
21 0.19
22 0.16
23 0.19
24 0.19
25 0.16
26 0.17
27 0.17
28 0.16
29 0.16
30 0.17
31 0.15
32 0.13
33 0.13
34 0.14
35 0.17
36 0.17
37 0.19
38 0.19
39 0.17
40 0.15
41 0.16
42 0.2
43 0.18
44 0.19
45 0.18
46 0.19
47 0.21
48 0.26
49 0.28
50 0.29
51 0.37
52 0.4
53 0.46
54 0.48
55 0.52
56 0.52
57 0.54
58 0.53
59 0.49
60 0.47
61 0.41
62 0.44
63 0.42
64 0.4
65 0.42
66 0.4
67 0.36
68 0.36
69 0.36
70 0.3
71 0.28
72 0.25
73 0.2
74 0.19
75 0.18
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.07
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.06
88 0.07
89 0.08
90 0.08
91 0.12
92 0.2
93 0.27
94 0.38
95 0.46
96 0.56
97 0.65
98 0.74
99 0.81
100 0.83
101 0.84
102 0.85
103 0.87
104 0.87
105 0.83
106 0.78
107 0.68
108 0.58
109 0.49
110 0.38
111 0.29
112 0.18
113 0.12
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.09
120 0.1
121 0.1
122 0.13
123 0.12
124 0.12
125 0.12
126 0.13
127 0.15
128 0.18
129 0.2
130 0.16
131 0.15
132 0.15
133 0.15
134 0.14
135 0.12
136 0.1
137 0.09
138 0.08
139 0.09
140 0.08
141 0.08
142 0.08
143 0.09
144 0.07
145 0.07
146 0.07
147 0.06
148 0.09
149 0.1
150 0.12
151 0.15
152 0.15
153 0.18
154 0.19
155 0.21
156 0.2
157 0.19
158 0.21
159 0.2
160 0.2
161 0.18
162 0.17
163 0.15
164 0.14
165 0.18
166 0.15
167 0.12
168 0.11
169 0.1
170 0.11
171 0.11
172 0.12
173 0.12
174 0.13
175 0.13
176 0.13
177 0.14
178 0.13
179 0.13
180 0.11
181 0.07
182 0.06
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.1
194 0.15
195 0.18
196 0.19
197 0.2
198 0.2
199 0.22
200 0.21
201 0.19
202 0.14
203 0.12
204 0.1
205 0.1
206 0.08
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.05
213 0.04
214 0.05
215 0.06
216 0.07
217 0.07
218 0.07
219 0.07
220 0.08
221 0.09
222 0.08
223 0.11
224 0.1
225 0.1
226 0.11
227 0.1
228 0.1
229 0.09
230 0.1
231 0.09
232 0.09
233 0.08
234 0.08
235 0.08
236 0.07
237 0.07
238 0.08
239 0.07
240 0.07
241 0.07
242 0.07
243 0.08
244 0.07
245 0.07
246 0.06
247 0.06
248 0.1
249 0.11
250 0.14
251 0.14
252 0.16
253 0.17
254 0.19
255 0.18
256 0.14
257 0.15
258 0.13
259 0.12
260 0.1
261 0.1
262 0.09
263 0.09
264 0.09
265 0.08
266 0.08
267 0.08
268 0.1
269 0.09
270 0.09
271 0.08
272 0.07
273 0.08
274 0.08
275 0.07
276 0.06
277 0.06
278 0.07
279 0.08
280 0.07
281 0.06
282 0.07
283 0.07
284 0.07
285 0.06
286 0.06
287 0.06
288 0.08
289 0.07
290 0.09
291 0.1
292 0.11
293 0.11
294 0.15
295 0.18
296 0.2
297 0.21
298 0.19
299 0.2
300 0.21
301 0.25
302 0.21
303 0.18
304 0.14
305 0.13
306 0.13
307 0.11
308 0.11
309 0.08
310 0.08
311 0.12
312 0.11
313 0.11
314 0.11
315 0.11
316 0.1
317 0.09
318 0.09
319 0.07
320 0.09
321 0.11
322 0.11
323 0.13
324 0.14
325 0.15
326 0.16
327 0.16
328 0.16
329 0.15
330 0.15
331 0.14
332 0.13
333 0.13
334 0.11
335 0.09
336 0.08
337 0.11
338 0.13
339 0.16
340 0.15
341 0.16
342 0.18
343 0.23
344 0.26
345 0.26
346 0.23
347 0.21
348 0.22
349 0.21
350 0.21
351 0.17
352 0.16
353 0.14
354 0.16
355 0.15
356 0.15
357 0.16
358 0.15
359 0.15
360 0.13
361 0.16
362 0.16
363 0.19
364 0.18
365 0.17
366 0.18
367 0.17
368 0.21
369 0.23
370 0.23
371 0.25
372 0.26
373 0.3
374 0.31
375 0.34
376 0.29
377 0.24
378 0.22
379 0.19
380 0.19
381 0.2
382 0.26
383 0.23
384 0.23
385 0.24
386 0.29
387 0.33
388 0.4
389 0.45
390 0.48
391 0.58
392 0.68
393 0.76
394 0.8
395 0.84
396 0.79
397 0.73
398 0.73
399 0.73
400 0.68
401 0.66
402 0.62
403 0.57
404 0.53
405 0.51
406 0.42
407 0.33
408 0.28
409 0.21
410 0.16
411 0.15
412 0.15
413 0.14
414 0.13
415 0.12
416 0.11
417 0.1
418 0.11
419 0.09
420 0.08
421 0.07
422 0.06
423 0.09
424 0.1
425 0.11
426 0.12
427 0.12
428 0.14
429 0.16
430 0.16
431 0.14
432 0.15
433 0.17
434 0.16
435 0.18
436 0.21
437 0.21
438 0.22
439 0.23
440 0.22
441 0.24