Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H0ZG69

Protein Details
Accession A0A2H0ZG69    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
22-50KMSSVKIVKKYTKKFKRHHSDRYKRVAENHydrophilic
NLS Segment(s)
PositionSequence
30-46KKYTKKFKRHHSDRYKR
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MGPFGAHLTRPPFLQLTDNTAKMSSVKIVKKYTKKFKRHHSDRYKRVAENWRKQKGIDSCVRRRFRGTIRQPNIGYGSNKKTKYLNPSGYKVYLVRNTQDLDALLMHNKTHAAEIAHNVSSKNRVEIVTKAKSLGVKVTNPKGRVALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.28
4 0.32
5 0.33
6 0.31
7 0.29
8 0.28
9 0.23
10 0.23
11 0.2
12 0.22
13 0.26
14 0.31
15 0.39
16 0.47
17 0.56
18 0.65
19 0.71
20 0.74
21 0.79
22 0.82
23 0.85
24 0.88
25 0.88
26 0.89
27 0.89
28 0.9
29 0.89
30 0.9
31 0.85
32 0.75
33 0.73
34 0.73
35 0.72
36 0.71
37 0.72
38 0.69
39 0.63
40 0.62
41 0.62
42 0.57
43 0.53
44 0.51
45 0.49
46 0.52
47 0.61
48 0.64
49 0.57
50 0.54
51 0.53
52 0.52
53 0.54
54 0.55
55 0.56
56 0.57
57 0.62
58 0.59
59 0.55
60 0.51
61 0.43
62 0.35
63 0.28
64 0.3
65 0.31
66 0.31
67 0.31
68 0.31
69 0.32
70 0.39
71 0.43
72 0.46
73 0.44
74 0.47
75 0.48
76 0.46
77 0.44
78 0.36
79 0.32
80 0.29
81 0.26
82 0.24
83 0.23
84 0.24
85 0.23
86 0.22
87 0.18
88 0.13
89 0.12
90 0.11
91 0.11
92 0.1
93 0.1
94 0.09
95 0.1
96 0.09
97 0.09
98 0.1
99 0.1
100 0.11
101 0.15
102 0.19
103 0.2
104 0.2
105 0.2
106 0.2
107 0.23
108 0.23
109 0.21
110 0.2
111 0.2
112 0.22
113 0.28
114 0.34
115 0.35
116 0.35
117 0.33
118 0.33
119 0.34
120 0.33
121 0.33
122 0.3
123 0.31
124 0.39
125 0.48
126 0.53
127 0.52
128 0.53
129 0.5