Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZCV4

Protein Details
Accession A0A2H0ZCV4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-52EKSKMAKSKNHTNHNQNKKAHKNGIKKPKTHRYRSLRNVDAHydrophilic
NLS Segment(s)
PositionSequence
26-60NQNKKAHKNGIKKPKTHRYRSLRNVDAKFRRNHRY
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MFTSTLDLQPFEKSKMAKSKNHTNHNQNKKAHKNGIKKPKTHRYRSLRNVDAKFRRNHRYALRGTAKALAAERENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.39
3 0.45
4 0.46
5 0.51
6 0.59
7 0.65
8 0.73
9 0.75
10 0.75
11 0.79
12 0.82
13 0.84
14 0.79
15 0.79
16 0.78
17 0.77
18 0.75
19 0.74
20 0.73
21 0.73
22 0.78
23 0.75
24 0.72
25 0.73
26 0.75
27 0.75
28 0.73
29 0.74
30 0.72
31 0.76
32 0.8
33 0.81
34 0.77
35 0.77
36 0.73
37 0.72
38 0.72
39 0.68
40 0.66
41 0.64
42 0.65
43 0.59
44 0.63
45 0.61
46 0.61
47 0.58
48 0.61
49 0.61
50 0.55
51 0.54
52 0.51
53 0.44
54 0.38
55 0.35
56 0.29