Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A681

Protein Details
Accession A0A2H1A681   
Localization Confidence High
Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22PSRNAVNKPKNKIHRAHHAQQHydrophilic
115-137DGESRIPRKKKHEKEPTHLDKVKBasic
NLS Segment(s)
PositionSequence
11-20KNKIHRAHHA
23-28LAKKRA
121-126PRKKKH
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MPSRNAVNKPKNKIHRAHHAQQLAKKRAARAATALPTRSSHGRYNKNTVPRPTDSKAVALYTGEGPTPSSGVTTNTLSGKRAKKLERNSRYIARRNEQLSIDLQAKEDMDIEMGDGESRIPRKKKHEKEPTHLDKVKQALWAVIDDTDAVGMNLNVTSEGTTIGVQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.81
4 0.79
5 0.78
6 0.76
7 0.73
8 0.71
9 0.73
10 0.68
11 0.65
12 0.6
13 0.54
14 0.52
15 0.49
16 0.44
17 0.38
18 0.39
19 0.4
20 0.41
21 0.39
22 0.35
23 0.34
24 0.35
25 0.34
26 0.31
27 0.32
28 0.37
29 0.46
30 0.49
31 0.56
32 0.59
33 0.65
34 0.67
35 0.65
36 0.62
37 0.57
38 0.59
39 0.53
40 0.52
41 0.44
42 0.39
43 0.35
44 0.29
45 0.24
46 0.17
47 0.16
48 0.12
49 0.11
50 0.09
51 0.08
52 0.08
53 0.07
54 0.08
55 0.06
56 0.06
57 0.06
58 0.07
59 0.09
60 0.1
61 0.11
62 0.13
63 0.13
64 0.14
65 0.2
66 0.22
67 0.24
68 0.3
69 0.33
70 0.39
71 0.48
72 0.58
73 0.59
74 0.61
75 0.62
76 0.64
77 0.65
78 0.66
79 0.62
80 0.54
81 0.53
82 0.49
83 0.47
84 0.4
85 0.35
86 0.28
87 0.24
88 0.23
89 0.18
90 0.16
91 0.14
92 0.13
93 0.12
94 0.11
95 0.09
96 0.06
97 0.06
98 0.06
99 0.05
100 0.05
101 0.05
102 0.04
103 0.04
104 0.07
105 0.1
106 0.17
107 0.21
108 0.27
109 0.38
110 0.49
111 0.59
112 0.67
113 0.76
114 0.78
115 0.83
116 0.88
117 0.86
118 0.86
119 0.8
120 0.7
121 0.65
122 0.59
123 0.52
124 0.44
125 0.36
126 0.27
127 0.24
128 0.24
129 0.19
130 0.16
131 0.13
132 0.1
133 0.09
134 0.08
135 0.07
136 0.06
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.06
146 0.07
147 0.08
148 0.08